KEGG   Takifugu rubripes (torafugu): 101064184Help
Entry
101064184         CDS       T02386                                 

Definition
histone deacetylase 10-like
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 589 aa AA seqDB search
MGTALIYDDEMTNYKLLWVDPACNIEVPERLTVCYEALMRTGLADRCVSIPVREATDADI
LLVHSEEYLEAVKKTPYMTLAELMEFTLQYGDVYFHPNIYHCAKLAAGAALQLVDSVMTG
AVRTGMALVRPPGHHSMRSAANGFCVFNNVAIAARYARQKYGLERVLIVDWDIHHGQGVQ
YCFEDDPSVLYFSWHRYEHQKFWPNLRESDYDTVGKEKGAGFNINVPWNRVGMRNSDYLS
VFFHILLPVAYEFCPDLVLVCAGFDSAIGDPEGEMCASPDIFAHLTHLLMNLAGGKLCAV
LEGGYNLTSLPQSVCQTVQTLLGDPAPPPGSLEGPSDLPTSESSSKHDKLAEETKDKAEK
ETVKEEKVWPEPQKRVCPPVRAALILPDNVTCPAGCQRFSSTEGLDPATISKLRVLIVCV
GDMVEQKPGTEDGKTLLVQFSGNISDKPIGKYHVPVCLKKGCGDVSGFMHAVLSLLLPLG
YEYDPNLVLLVRMPGCGIWDSVWQQLTGLLQGLAQGHTLILMQEEEKPCFVPTVSCLLGN
APPSLASLCAPLPEDTEEVEKLRYHLQADWKLLQTTGEFTTTSSMSCDI
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgcactaatttatgacgacgagatgaccaattacaaattgctctgggttgat
cctgcatgtaatattgaggtacccgagcgtctgacagtatgttatgaggctctgatgagg
actgggctggccgatcgctgtgtctccatccctgtccgggaggcaacagatgctgacatt
ctgctggtccatagtgaggagtatttagaagccgtgaagaaaaccccctatatgactcta
gcggaacttatggaattcactctgcaatacggcgacgtctacttccacccaaacatttat
cactgtgccaagctggctgcaggtgctgccctgcaactggtggacagtgtaatgacggga
gctgtgaggaccggcatggcgctggtcaggcctccaggacatcacagtatgcgcagtgct
gccaatgggttctgtgtattcaataatgttgccatagcggcgcgatatgcgaggcaaaaa
tacggcctggaaagggtgttgatagtggactgggatatacatcacggtcaaggggtacaa
tactgttttgaggacgatccaagtgtgctctacttctcctggcaccgctacgagcatcag
aaattctggcccaaccttagagaatcagactacgacactgttggcaaagaaaagggagcc
ggattcaacataaatgtgccgtggaatagggttggaatgcgaaacagtgactatctttca
gtcttctttcacatcctgttaccagttgcctatgagttttgccctgacctggtcctggta
tgtgcaggttttgactcggctatcggtgacccagagggtgaaatgtgtgccagtccagac
atctttgctcatcttactcacctcctgatgaacctggctggaggcaaactgtgtgcagtt
ctggagggaggctacaacttgacctccctcccacagtctgtgtgtcagacagtccaaacc
ttacttggagatcctgctcctccacctgggagcctcgaagggccctctgacttgcccacc
tctgagagcagctcaaagcatgataaattagcagaagaaacaaaggacaaggcagaaaag
gagacagttaaagaggaaaaagtgtggcccgagccccagaagcgcgtctgtcctcccgtc
cgtgctgctttaatcctccctgataacgtcacctgcccggctggatgtcagcgcttcagc
tcaacagaaggtctggatccagcaacaatcagcaagctcagggttttaatcgtgtgtgtt
ggagacatggtggaacagaagcctggcaccgaggatgggaaaacgctcctggtgcagttc
agtgggaatatatcggacaagccgataggcaaatatcatgttccagtgtgtctgaagaag
ggctgcggtgatgtgtcagggttcatgcatgcggttctcagcctcctcctgcctcttggc
tatgagtacgacccaaatctggtgctgttggtccgaatgcctggttgtggaatttgggac
agcgtatggcaacaactaacaggcctactgcaaggcctggcccagggacacacactgata
ctcatgcaggaagaggagaagccgtgttttgtccccacagtctcctgtctcctgggaaac
gcccctccctctctggcgagtctttgtgctcctttaccagaagacacggaggaagtagag
aagctccgttatcacctgcaggcggactggaaactcctgcagacaaccggtgaatttaca
acaacatcgtccatgtcctgtgatatttaa

DBGET integrated database retrieval system