KEGG   Takifugu rubripes (torafugu): 101064184Help
Entry
101064184         CDS       T02386                                 

Gene name
hdac10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  
histone deacetylase 10 [EC:3.5.1.98]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101064184 (hdac10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 669 aa AA seqDB search
MGTALIYDDEMTNYKLLWVDPACNIEVPERLTVCYEALMRTGLADRCVSIPVREATDADI
LLVHSEEYLEAVKKTPYMTLAELMEFTLQYGDVYFHPNIYHCAKLAAGAALQLVDSVMTG
AVRTGMALVRPPGHHSMRSAANGFCVFNNVAIAARYARQKYGLERVLIVDWDIHHGQGVQ
YCFEDDPSVLYFSWHRYEHQKFWPNLRESDYDTVGKEKGAGFNINVPWNRVGMRNSDYLS
VFFHILLPVAYEFCPDLVLVCAGFDSAIGDPEGEMCASPDIFAHLTHLLMNLAGGKLCAV
LEGGYNLTSLPQSVCQTVQTLLGDPAPPPGSLEGPCRSALESLHCVRSAHKPYWSCLKYA
ADLPTSESSSKHDKLAEETKDKAEKETVKEEKVWPEPQKRVCPPVRAALILPDNVTCPAG
CQRFSSTEGLDPATISKLREKFSKDGENNSSLTTLPSLVALVDKMENHEIYSGLALVQDV
SMAMTCTVQHAAALFQRVLIVCVGDMVEQKPGTEDGKTLLVQFSGNISDKPIGKYHVPVC
LKKGCGDVSGFMHAVLSLLLPLGYEYDPNLVLLVRMPGCGIWDSVWQQLTGLLQGLAQGH
TLILMQEEEKPCFVPTVSCLLGNAPPSLASLCAPLPEDTEEVEKLRYHLQADWKLLQTTA
PEPQGSDGP
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgcactaatttatgacgacgagatgaccaattacaaattgctctgggttgat
cctgcatgtaatattgaggtacccgagcgtctgacagtatgttatgaggctctgatgagg
actgggctggccgatcgctgtgtctccatccctgtccgggaggcaacagatgctgacatt
ctgctggtccatagtgaggagtatttagaagccgtgaagaaaaccccctatatgactcta
gcggaacttatggaattcactctgcaatacggcgacgtctacttccacccaaacatttat
cactgtgccaagctggctgcaggtgctgccctgcaactggtggacagtgtaatgacggga
gctgtgaggaccggcatggcgctggtcaggcctccaggacatcacagtatgcgcagtgct
gccaatgggttctgtgtattcaataatgttgccatagcggcgcgatatgcgaggcaaaaa
tacggcctggaaagggtgttgatagtggactgggatatacatcacggtcaaggggtacaa
tactgttttgaggacgatccaagtgtgctctacttctcctggcaccgctacgagcatcag
aaattctggcccaaccttagagaatcagactacgacactgttggcaaagaaaagggagcc
ggattcaacataaatgtgccgtggaatagggttggaatgcgaaacagtgactatctttca
gtcttctttcacatcctgttaccagttgcctatgagttttgccctgacctggtcctggta
tgtgcaggttttgactcggctatcggtgacccagagggtgaaatgtgtgccagtccagac
atctttgctcatcttactcacctcctgatgaacctggctggaggcaaactgtgtgcagtt
ctggagggaggctacaacttgacctccctcccacagtctgtgtgtcagacagtccaaacc
ttacttggagatcctgctcctccacctgggagcctcgaagggccctgtaggagtgcgctt
gaatcccttcactgtgtgcgatcggctcataagccttactggtcctgcctcaaatacgca
gctgacttgcccacctctgagagcagctcaaagcatgataaattagcagaagaaacaaag
gacaaggcagaaaaggagacagttaaagaggaaaaagtgtggcccgagccccagaagcgc
gtctgtcctcccgtccgtgctgctttaatcctccctgataacgtcacctgcccggctgga
tgtcagcgcttcagctcaacagaaggtctggatccagcaacaatcagcaagctcagggag
aaattctccaaagatggagagaataacagttccctcaccaccctccccagtctcgtcgcc
ctcgtagacaaaatggagaatcatgagatttacagtggcttggcacttgtccaagatgtc
tccatggcgatgacgtgcactgtccagcacgctgcagctctctttcaacgggttttaatc
gtgtgtgttggagacatggtggaacagaagcctggcaccgaggatgggaaaacgctcctg
gtgcagttcagtgggaatatatcggacaagccgataggcaaatatcatgttccagtgtgt
ctgaagaagggctgcggtgatgtgtcagggttcatgcatgcggttctcagcctcctcctg
cctcttggctatgagtacgacccaaatctggtgctgttggtccgaatgcctggttgtgga
atttgggacagcgtatggcaacaactaacaggcctactgcaaggcctggcccagggacac
acactgatactcatgcaggaagaggagaagccgtgttttgtccccacagtctcctgtctc
ctgggaaacgcccctccctctctggcgagtctttgtgctcctttaccagaagacacggag
gaagtagagaagctccgttatcacctgcaggcggactggaaactcctgcagacaaccgca
cctgaacctcaaggatctgatggaccctga

DBGET integrated database retrieval system