KEGG   Takifugu rubripes (torafugu): 101064193Help
Entry
101064193         CDS       T02386                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101064193
   04142 Lysosome
    101064193
Exosome [BR:tru04147]
 Exosomal proteins
  Proteins found in most exosomes
   101064193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 1678 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQTQVVIIDMADPNT
PIRRPISADSAIMNPASKVIALKAAKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGDSQPVKVFDRHSSLAGCQIINYRTDAKQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAGFAQFKMEGNSEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQVSAKHNVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATSGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRLAVRNNLAGA
EELFARKFNNLFAAGNYSEAAKVAANAPKGILRTPDTIRRFQSVPTQPGQTSPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKAVDPTLALSVYL
RANVPNKVIQCFAETGQFPKIVLYAKKVGYTPDWIFLLRNVMRINPEQGLQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTSFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQALTELFESFKSFEGLFYFLGSIVN
FSQDPEVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDVIKSLILVVRGQF
STDELVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPFY
DSRVVGKYCEKRDPHLSCVAYERGQCDQELINVCNENSLFKSLSRYLVRRKDPELWASVL
LESNPFRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYISRLDNYDAPDIANIAISNELFEEAFAIFKKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKDLVKEAIDSYIKADDPSAYMEV
VQAADRSGNWEDLVKFLQMARKKARESYVETELIFALAKTYRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYEAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYKAVQFYLEFKPLLLNDLLMVLSPRLDHSRAVNFFS
KVKQLPLVKPYLRSVQNHNNKSVNEALNNLFIIEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDKLYKDAMQYASESKDIELAEELLSWFLQE
DKKECFAACLFSCYDLLRPDVVLETAWRHNIMDFSMPYFIQVMREYLSKVDKLESSESVR
KEEEQATETQPIVYGTPQLMLTAGPSVPVAPQQAYGYGYQAPAGYTQPAPQPGFTYGM
NT seq 5037 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatcctgcctattcgctttcaggagcacctgcagcttcaaaacctggggatt
aacccagccaacattggctttagcaccttaactatggagtcggataaattcatctgcatc
cgtgagaaggtgggcgagcagactcaggtggtcatcatcgacatggcggaccccaatact
cccatccgcaggcccatctcggctgacagcgccatcatgaatccagccagcaaggtcata
gccctcaaagctgccaaaactcttcagatttttaacattgaaatgaagagcaagatgaag
gcgcataccatgacagatgatgttaccttctggaagtggatctccctgaacactgttgca
cttgtgactgacaatgctgtgtaccactggagtatggagggagactcacaacctgtaaaa
gtctttgaccgccattccagcctggcaggatgtcagatcatcaactaccgcacagatgcc
aaacagaaatggcttctgctcattggcatctcagcccagcaaaatcgggtagtaggtgcc
atgcagctctactcggttgaccgaaaggtctctcagcctattgagggccatgctgcaggt
tttgcccagttcaagatggagggaaattctgaggagtcaaccctgttctgcttcgccgtc
agaggccaggctggagggaagttgcacatcatcgaagtggggacaccaccaactggcaat
cagccatttccaaagaaagcagtggacgtgttcttccctccagaagcccagaatgatttc
cctgtggccatgcaggtgagcgccaagcacaatgttgttttccttattaccaaatatggg
tacattcacttgtatgacctggagacgggcacctgcatctacatgaaccgcatcagtggg
gagaccatctttgtcactgcaccacatgaggccacgtcaggcatcatcggagtgaacagg
aaggggcaggtcctctcggtctgtgtggaagaggaaaacatcatcccgtacattacaaat
gtgctacagaatccagatctggctcttcgcttggctgtccgcaacaaccttgctggagcc
gaagagctctttgcacgcaagttcaacaacctgtttgctgctggaaactactcagaagct
gcaaaagttgctgcaaatgcaccaaagggtatcctgcgaaccccagacaccattcgccgt
tttcagagtgttccaactcagcctggccagacctccccattgctgcagtactttggcatc
ttgttggaccagggccagctgaacaaatttgagtcccttgagctatgcaggcctgttctc
caacaaggacggaagcagcttcttgaaaagtggctaaaggaggataagcttgaatgctca
gaggaactgggtgacctagtgaaagcagtggatcccaccttggccctcagtgtttacctc
agagccaatgtccccaacaaagtaatccagtgttttgcagagactggtcagttccccaag
attgtactgtatgccaagaaggtgggctacactccagactggatctttttactcagaaat
gtaatgaggatcaacccagaacaaggcttgcagttcgctcaaatgctggtgcaggatgaa
gaaccacttgctgacattacacagatcgtggatgtatttatggaatacaacctgatccag
cagtgcacatctttcctcttggatgctttgaagaacaaccggccttcagagggaccgctg
cagactcgtctgctggagatgaacctcatgcatgctccacaggttgccgatgctatcctt
ggtaaccaaatgttcactcactatgatcgagcacacatcgcccagttgtgtgagaaagct
ggactcctgcagagggcactggagcactacactgacctctatgacattaagcgtgctgtg
gtgcacacacacctactaaatccagagtggttggtgaacttttttggctcgctgtcggtg
gaagactctttggagtgccttagagccatgttgtcggctaatatccggcagaacttgcag
atctgcgttcaggtggcttctaagtaccatgaacaactctccacacaagcgcttactgag
ctttttgaatccttcaagagctttgaaggtctgttctactttttgggctctattgtgaac
ttcagccaggatcctgaagttcacttcaaatacattcaggctgcctgtaagacgggtcag
atcaaagaggtggagcgaatctgtcgagagagtaactgctacgacccagagcgtgtcaag
aactttctcaaggaagctaaactcaccgaccaactgccactgatcatcgtctgtgaccga
tttgactttgtccatgacctggtcctctacctgtaccgcaacaatctgcagaagtacatt
gagatctacgttcagaaggtaaaccccagccgtctgcctgttgtggttggtggcctgttg
gatgtagactgctcagaggatgtcatcaagagcctgatcctggtagtcagaggccagttc
tcaactgatgaactcgttgctgaagtggaaaagaggaacagactgaagcttctgctgcct
tggctggagtcacgtatccacgaaggctgtgaagaacccgccacgcataatgctctggca
aagatctacatcgacagcaacaacaacccagaacgtttcctgagagagaacccattttac
gacagccgtgtggttggaaagtactgtgagaagagagacccccatttgtcctgtgttgcc
tatgagaggggacagtgtgaccaggagctgatcaatgtatgcaatgagaactcccttttc
aagagcttgtctcgctacctggtccggcgcaaagatccagagctttgggccagtgtgttg
ctggagagcaaccccttcaggcggccacttattgaccaggtggtacagacagccctgtca
gaaactcaggacccagaggaggtctcggtcacagtcaaggccttcatgactgctgatttg
cccaatgagctcattgagctactggagaagattgtgttggacaattctgtcttcagtgaa
cacagaaatctgcagaacctgctgatcctgacggcaattaaagctgatcgtacccgtgtg
atggaatacatcagcaggctagacaactacgatgctcctgatattgctaacatcgccatc
agcaatgagctctttgaggaggcctttgccatattcaagaagtttgacgtaaacacctct
gcagtgcaggtgctgattgagcatattggaaacctggaccgggcctatgagtttgcggaa
cgctgcaatgaaccagctgtgtggagccagctggctaaggctcagctgcagaaggacctg
gttaaagaggccatcgactcctacataaaagctgacgacccctctgcatacatggaggtg
gtacaggctgctgacaggagtggtaactgggaagacttggtcaagttcctgcagatggct
cgtaagaaggcccgtgagtcttacgttgagacggagctcatctttgccttggccaaaaca
tatcgcctggctgaactggaggaatttatcaatgggcctaacaacgctcacatccagcag
gttggtgaccgctgctacgatgagaaaatgtatgaagccgccaagctgctatacaacaac
gtctccaactttgggcgtctggcatcgacactggttcacctcggggagtaccaggctgct
gtggatggcgcccgcaaggcgaacagcacccgtacctggaaagaagtgtgctttgcgtgt
gtagatgggaaagaattccgattggcccaaatgtgtggtcttcacatcgtggtgcatgct
gatgaactggaagagctcatcaactactaccaggatcgtggttactttgaggagttgatc
accatgctggaggcggctctgggcctggagcgtgctcacatgggcatgttcacagagctc
gcgatcctttactcaaagttcaaaccccagaagatgagggaacacctggagctcttctgg
tcaagagttaatattcccaaagtcctgagagcagctgagcaggctcacctgtgggccgag
ctggtcttcctctatgacaagtatgaagagtatgataacgcgatcataaccatgatgaac
cacccgacagatgcctggaaggaggggcagttcaaagatataattaccaaggtggccaat
gtggagttgtactacaaagccgttcagttctatctggagttcaagcctttgttactgaac
gatttactgatggtgctgtctccccgactggatcactcgcgtgctgtcaacttcttcagc
aaggtgaaacagctgcccttagtcaaaccctacctgcggtcagtccagaaccacaacaac
aaatcggtcaacgaagcacttaacaacctcttcatcatcgaggaggattatcaggcgttg
aggacatcaatagatgcctatgacaactttgacaacatctcactggcgcagcgcttggag
aagcacgagctgattgaatttaggagaattgctgcctacctgttcaagggcaacaaccgt
tggaaacagagcgttgagctctgcaagaaagacaagctctataaggatgccatgcagtat
gcatcggaatccaaggacattgagctggcagaggagctgttatcttggtttctgcaggag
gacaagaaggaatgttttgccgcttgcttgttttcctgctatgacctgctgcgcccagat
gtggttttggagacggcctggagacacaacatcatggacttctcaatgccatattttatt
caggtcatgagggagtacctcagcaaggtagacaaactagaatcctcagagtccgtgagg
aaagaagaagagcaggccacagagacgcaacccattgtttatggcacacctcagctgatg
ctgacagcaggtcccagtgtacctgtggcccctcagcaagcctatggctatggctaccag
gcacctgcaggatacactcagccagcacctcagcccggtttcacctatggcatgtag

DBGET integrated database retrieval system