KEGG   Takifugu rubripes (torafugu): 101064193Help
Entry
101064193         CDS       T02386                                 

Gene name
cltc
Definition
(RefSeq) clathrin, heavy chain (Hc)
  KO
K04646  
clathrin heavy chain
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101064193 (cltc)
   04142 Lysosome
    101064193 (cltc)
Exosome [BR:tru04147]
 Exosomal proteins
  Proteins found in most exosomes
   101064193 (cltc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 1678 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQTQVVIIDMADPNT
PIRRPISADSAIMNPASKVIALKAAKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGDSQPVKVFDRHSSLAGCQIINYRTDAKQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAGFAQFKMEGNSEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQVSAKHNVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATSGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRLAVRNNLAGA
EELFARKFNNLFAAGNYSEAAKVAANAPKGILRTPDTIRRFQSVPTQPGQTSPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKAVDPTLALSVYL
RANVPNKVIQCFAETGQFPKIVLYAKKVGYTPDWIFLLRNVMRINPEQGLQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTSFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQALTELFESFKSFEGLFYFLGSIVN
FSQDPEVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDVIKSLILVVRGQF
STDELVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPFY
DSRVVGKYCEKRDPHLSCVAYERGQCDQELINVCNENSLFKSLSRYLVRRKDPELWASVL
LESNPFRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYISRLDNYDAPDIANIAISNELFEEAFAIFKKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKDLVKEAIDSYIKADDPSAYMEV
VQAADRSGNWEDLVKFLQMARKKARESYVETELIFALAKTYRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYEAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYKAVQFYLEFKPLLLNDLLMVLSPRLDHSRAVNFFS
KVKQLPLVKPYLRSVQNHNNKSVNEALNNLFIIEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDKLYKDAMQYASESKDIELAEELLSWFLQE
DKKECFAACLFSCYDLLRPDVVLETAWRHNIMDFSMPYFIQVMREYLSKVDKLESSESVR
KEEEQATETQPIVYGTPQLMLTAGPSVPVAPQQAYGYGYQAPAGYTQPAPQPGFTYGM
NT seq 5037 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatcctgcctattcgctttcaggagcacctgcagcttcaaaacctggggatt
aacccagccaacattggctttagcaccttaactatggagtcggataaattcatctgcatc
cgtgagaaggtgggcgagcagactcaggtggtcatcatcgacatggcggaccccaatact
cccatccgcaggcccatctcggctgacagcgccatcatgaatccagccagcaaggtcata
gccctcaaagctgccaaaactcttcagatttttaacattgaaatgaagagcaagatgaag
gcgcataccatgacagatgatgttaccttctggaagtggatctccctgaacactgttgca
cttgtgactgacaatgctgtgtaccactggagtatggagggagactcacaacctgtaaaa
gtctttgaccgccattccagcctggcaggatgtcagatcatcaactaccgcacagatgcc
aaacagaaatggcttctgctcattggcatctcagcccagcaaaatcgggtagtaggtgcc
atgcagctctactcggttgaccgaaaggtctctcagcctattgagggccatgctgcaggt
tttgcccagttcaagatggagggaaattctgaggagtcaaccctgttctgcttcgccgtc
agaggccaggctggagggaagttgcacatcatcgaagtggggacaccaccaactggcaat
cagccatttccaaagaaagcagtggacgtgttcttccctccagaagcccagaatgatttc
cctgtggccatgcaggtgagcgccaagcacaatgttgttttccttattaccaaatatggg
tacattcacttgtatgacctggagacgggcacctgcatctacatgaaccgcatcagtggg
gagaccatctttgtcactgcaccacatgaggccacgtcaggcatcatcggagtgaacagg
aaggggcaggtcctctcggtctgtgtggaagaggaaaacatcatcccgtacattacaaat
gtgctacagaatccagatctggctcttcgcttggctgtccgcaacaaccttgctggagcc
gaagagctctttgcacgcaagttcaacaacctgtttgctgctggaaactactcagaagct
gcaaaagttgctgcaaatgcaccaaagggtatcctgcgaaccccagacaccattcgccgt
tttcagagtgttccaactcagcctggccagacctccccattgctgcagtactttggcatc
ttgttggaccagggccagctgaacaaatttgagtcccttgagctatgcaggcctgttctc
caacaaggacggaagcagcttcttgaaaagtggctaaaggaggataagcttgaatgctca
gaggaactgggtgacctagtgaaagcagtggatcccaccttggccctcagtgtttacctc
agagccaatgtccccaacaaagtaatccagtgttttgcagagactggtcagttccccaag
attgtactgtatgccaagaaggtgggctacactccagactggatctttttactcagaaat
gtaatgaggatcaacccagaacaaggcttgcagttcgctcaaatgctggtgcaggatgaa
gaaccacttgctgacattacacagatcgtggatgtatttatggaatacaacctgatccag
cagtgcacatctttcctcttggatgctttgaagaacaaccggccttcagagggaccgctg
cagactcgtctgctggagatgaacctcatgcatgctccacaggttgccgatgctatcctt
ggtaaccaaatgttcactcactatgatcgagcacacatcgcccagttgtgtgagaaagct
ggactcctgcagagggcactggagcactacactgacctctatgacattaagcgtgctgtg
gtgcacacacacctactaaatccagagtggttggtgaacttttttggctcgctgtcggtg
gaagactctttggagtgccttagagccatgttgtcggctaatatccggcagaacttgcag
atctgcgttcaggtggcttctaagtaccatgaacaactctccacacaagcgcttactgag
ctttttgaatccttcaagagctttgaaggtctgttctactttttgggctctattgtgaac
ttcagccaggatcctgaagttcacttcaaatacattcaggctgcctgtaagacgggtcag
atcaaagaggtggagcgaatctgtcgagagagtaactgctacgacccagagcgtgtcaag
aactttctcaaggaagctaaactcaccgaccaactgccactgatcatcgtctgtgaccga
tttgactttgtccatgacctggtcctctacctgtaccgcaacaatctgcagaagtacatt
gagatctacgttcagaaggtaaaccccagccgtctgcctgttgtggttggtggcctgttg
gatgtagactgctcagaggatgtcatcaagagcctgatcctggtagtcagaggccagttc
tcaactgatgaactcgttgctgaagtggaaaagaggaacagactgaagcttctgctgcct
tggctggagtcacgtatccacgaaggctgtgaagaacccgccacgcataatgctctggca
aagatctacatcgacagcaacaacaacccagaacgtttcctgagagagaacccattttac
gacagccgtgtggttggaaagtactgtgagaagagagacccccatttgtcctgtgttgcc
tatgagaggggacagtgtgaccaggagctgatcaatgtatgcaatgagaactcccttttc
aagagcttgtctcgctacctggtccggcgcaaagatccagagctttgggccagtgtgttg
ctggagagcaaccccttcaggcggccacttattgaccaggtggtacagacagccctgtca
gaaactcaggacccagaggaggtctcggtcacagtcaaggccttcatgactgctgatttg
cccaatgagctcattgagctactggagaagattgtgttggacaattctgtcttcagtgaa
cacagaaatctgcagaacctgctgatcctgacggcaattaaagctgatcgtacccgtgtg
atggaatacatcagcaggctagacaactacgatgctcctgatattgctaacatcgccatc
agcaatgagctctttgaggaggcctttgccatattcaagaagtttgacgtaaacacctct
gcagtgcaggtgctgattgagcatattggaaacctggaccgggcctatgagtttgcggaa
cgctgcaatgaaccagctgtgtggagccagctggctaaggctcagctgcagaaggacctg
gttaaagaggccatcgactcctacataaaagctgacgacccctctgcatacatggaggtg
gtacaggctgctgacaggagtggtaactgggaagacttggtcaagttcctgcagatggct
cgtaagaaggcccgtgagtcttacgttgagacggagctcatctttgccttggccaaaaca
tatcgcctggctgaactggaggaatttatcaatgggcctaacaacgctcacatccagcag
gttggtgaccgctgctacgatgagaaaatgtatgaagccgccaagctgctatacaacaac
gtctccaactttgggcgtctggcatcgacactggttcacctcggggagtaccaggctgct
gtggatggcgcccgcaaggcgaacagcacccgtacctggaaagaagtgtgctttgcgtgt
gtagatgggaaagaattccgattggcccaaatgtgtggtcttcacatcgtggtgcatgct
gatgaactggaagagctcatcaactactaccaggatcgtggttactttgaggagttgatc
accatgctggaggcggctctgggcctggagcgtgctcacatgggcatgttcacagagctc
gcgatcctttactcaaagttcaaaccccagaagatgagggaacacctggagctcttctgg
tcaagagttaatattcccaaagtcctgagagcagctgagcaggctcacctgtgggccgag
ctggtcttcctctatgacaagtatgaagagtatgataacgcgatcataaccatgatgaac
cacccgacagatgcctggaaggaggggcagttcaaagatataattaccaaggtggccaat
gtggagttgtactacaaagccgttcagttctatctggagttcaagcctttgttactgaac
gatttactgatggtgctgtctccccgactggatcactcgcgtgctgtcaacttcttcagc
aaggtgaaacagctgcccttagtcaaaccctacctgcggtcagtccagaaccacaacaac
aaatcggtcaacgaagcacttaacaacctcttcatcatcgaggaggattatcaggcgttg
aggacatcaatagatgcctatgacaactttgacaacatctcactggcgcagcgcttggag
aagcacgagctgattgaatttaggagaattgctgcctacctgttcaagggcaacaaccgt
tggaaacagagcgttgagctctgcaagaaagacaagctctataaggatgccatgcagtat
gcatcggaatccaaggacattgagctggcagaggagctgttatcttggtttctgcaggag
gacaagaaggaatgttttgccgcttgcttgttttcctgctatgacctgctgcgcccagat
gtggttttggagacggcctggagacacaacatcatggacttctcaatgccatattttatt
caggtcatgagggagtacctcagcaaggtagacaaactagaatcctcagagtccgtgagg
aaagaagaagagcaggccacagagacgcaacccattgtttatggcacacctcagctgatg
ctgacagcaggtcccagtgtacctgtggcccctcagcaagcctatggctatggctaccag
gcacctgcaggatacactcagccagcacctcagcccggtttcacctatggcatgtag

DBGET integrated database retrieval system