KEGG   Takifugu rubripes (torafugu): 101064230Help
Entry
101064230         CDS       T02386                                 

Definition
protein O-mannosyl-transferase 2-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101064230
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     101064230
Glycosyltransferases [BR:tru01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   101064230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 706 aa AA seqDB search
MFAVRFSKGEASDGPSEVVLQMLVMGLSLSTRFYKITQPPHVCWDETHFGKMGSYYINRT
FFFDVHPPLGKMLIGLAGHMTGYNGTFPFLKPGDKYEHHNYWGMRGFCAGLGSFLPIFAY
LIVLDLSQSRSAALITASLLIFDTGCITISQYILLDPILMFFIMAAVLSMVKFNRQRHRP
FSVPWWLWLVLTGVSLAGALGVKFVGLFVILLVGLNTLSDLWRLLGDLSLSLMEVTKHFL
ARVVGLIVLPLLLYVAIFAVHFLVLNKSGPGDGFFSSAFQSRLIGNNLHNASMPEFLAYG
STITVKNLRIAGGYLHSHWHLYPEGVGAKQQQVTAYHHKDYNNLWIVQRQQNDEYPSESP
ELVRHGDIIRLEHKETTRNLHSHLHEAPVTKRHFQVTGYGTNGSGDANDLWKVELSGGQK
GDLVKVLRSKVRFIHRASGCVLYSSGKTLPKWGWEQGEVTCSPYLKETPNSQWNIEDHIN
PKLPNISLSILKPNFLEILLESHIVMIRGNSGLKPKDNEMTSKPWHWPINYQGLRFSGVN
NSDYRVYLLGNPVVWWLNLASLGLYIVMVVVTSVALQRGLSLGANIIGRSAVLRGGGGLL
LLGWALHYAPFYAMGRVLYYHHYFPAMLFNSMLSGITLDILLKSSDAVLQPPYCDWLQRF
GQTVLLFSVFYSFYLFHPLSYGMTGPLAHEQGSTMAGLKWMDSWEF
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctgtaaggttttcgaaaggggaagcctctgatggaccttcagaagttgtgctg
cagatgttggtgatggggttgtctttgtctacgcgcttctataagatcacacagcctcca
catgtgtgttgggatgagacacactttggaaagatgggaagctactacatcaacaggacc
ttcttttttgatgtgcatcctccacttggaaaaatgctgattggtcttgctggtcacatg
actggttacaacggcacctttcctttcctaaagccgggagataaatatgaacaccacaac
tactgggggatgagaggattttgtgcaggactgggctcttttctcccaatctttgcctac
ctcatagtgcttgatttatctcagtctcgctctgctgccctcatcaccgcctcgctgctc
atctttgatactggatgtatcaccatttctcagtatatcctgttggatccgatactcatg
ttcttcatcatggcagccgtgctgagcatggtcaagtttaacaggcaaagacacaggcct
ttttctgtcccctggtggttgtggctggtactgacaggtgtaagccttgctggggcacta
ggggtgaagtttgtgggtctgtttgtcatcctgctggtgggactgaacacgctctcagac
ctttggagacttttgggcgaccttagcctctcactgatggaagtcactaagcacttcctg
gctcgggtggttggactcatcgtgcttccactcctcctctatgtcgcaatatttgcagtc
cattttcttgtgttaaataaaagtggaccaggagatggtttcttcagttccgcttttcag
tcacgcctcattgggaacaatctacacaatgcgtctatgcctgagttcctggcatacggg
tccaccattacagtgaagaacctccgtattgctggtggatatttgcactctcattggcac
ctttatccagagggagttggggcaaagcaacagcaggtgacggcttatcatcataaggac
tacaacaacttgtggattgttcagagacaacagaatgatgaatatccatctgagtcacct
gagctggttcgccatggcgacatcattcgcctggaacacaaagaaacaacacgcaacctt
cacagtcacctgcacgaggccccagtcaccaagaggcacttccaggttaccggctacggc
accaatggctcaggcgacgccaatgacctatggaaagtggagttatccggaggtcagaag
ggtgatctggtgaaagtgttgcgcagcaaagttcgcttcattcaccgagcatccggctgt
gtgctttactcctccggcaagactctgcccaagtggggctgggaacagggggaggtgacc
tgtagtccctatttgaaggagactccaaactctcagtggaacatcgaggaccatatcaat
ccgaaactgcccaacattagtttgtctatactgaagcccaattttctggagatcctgctg
gagtctcatatcgtcatgatcagaggcaacagtggtctgaaacccaaagacaatgagatg
acctctaaaccctggcattggcccatcaattatcaaggattgaggttttctggagttaac
aattcagattatcgtgtttacctactggggaaccccgtggtttggtggctgaatttggcc
agtttggggctgtacattgtcatggtggtggtgacatctgtagcgctgcagagagggctc
tcgctgggtgcaaacataatagggcgttctgctgtgctgagaggaggaggaggactgctg
cttctgggatgggcgctgcattacgcacccttctacgccatgggccgggtgctttactac
caccactattttcctgcgatgctcttcaacagcatgttatcaggaattactttagacatt
ttactgaaaagctcagatgcggttctccaaccaccttattgtgactggctgcagaggttt
gggcagactgtccttctctttagtgttttttacagtttctatctgttccatccactctcc
tatggcatgacaggccccctggcacacgagcaaggcagcaccatggccggcctcaagtgg
atggactcctgggagttctga

DBGET integrated database retrieval system