KEGG   Takifugu rubripes (torafugu): 101064319Help
Entry
101064319         CDS       T02386                                 

Definition
protein disulfide-isomerase A4-like
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tru04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 637 aa AA seqDB search
MKKLALLLIVLLGVAHLIPAGKCEDDDAENENTEEESDDEEEEEDDDDTEVKEENGVLVL
TDGNYDTFMEGKDTVLVEFYAPWCGHCKQFAPEYEKIAESLKENDPPIPVAKVDAVLSSG
LGSRFDVSGYPTIKIIKNGEPVDYDGERTEKAIVERVKEVAQPDWKPPPEATLVLTKDNF
DDTVNGADIILVEFYAPWCGHCKRLAPEYEKAASLLSQRSPPIPLAKVDATVEAELASRF
GVSGYPTLKIFRKGKVFDYNGPREKYGIVDHMVEQSGPPSKQVQAAKQVQELIKDGDDAV
IVGIFSSEQDAAFEIYIEACNALREDFTFRHTFNSEVSNLLKASPGQVMIVQPEKFRSKY
EPASHTLAIKDDTLVSEVQEFFKKNVIPLVGHRKPSNDAKRYTKRPLVVVYYGVDFSFDY
RKATQFWRSKVLEVAKDFPEYVFAIADEEDYGEELKSLGLSESGEEVNVGILEDGGKKFA
MEPEELDADVLRDFVMAFKKGKLKPIIKSQPVPKNNKGPVKVVVGKTFDEIVMDTQKDVL
IEFYAPWCGHCKKLEPDYLALAKKYKGEKNLVIAKMDATANDVPNDGYKVEGFPTIYFAT
SNSKQTPIKFEGGDRTLEGFSSFLEKHATKLSQKDEL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagctcgctctactgctcattgtgctgctcggcgtcgcacatttgatacctgcg
ggcaaatgtgaagacgatgatgcagaaaatgagaataccgaagaggagagtgatgatgaa
gaagaggaggaggatgatgatgacacagaggtgaaagaagaaaacggagtgctggtcctc
actgatggcaactacgatactttcatggaaggcaaagacacagttctggtcgaattttat
gcaccctggtgtggccactgtaaacagtttgcacctgagtatgagaaaatagcagagagc
ctgaaggagaatgacccccctattcctgtggccaaagttgatgctgtgttgtccagcggt
ttaggaagtaggtttgatgtgtcaggctatcccaccatcaagatcattaaaaatggggag
cctgtggactatgatggagagaggacagaaaaagccatcgttgaacgggtgaaagaggta
gcgcagcctgattggaagccccctcctgaagctacgctggtgctgacaaaggacaacttt
gatgataccgttaatggagcggacataatcctggtggagttttacgccccatggtgtgga
cactgtaagcgcttggcgccagagtatgagaaggctgcctcactgcttagccagcggtcc
ccccctattcctctggccaaggtggatgccaccgtggaagctgaactggcttcacgcttc
ggagtttcaggctatcccacactgaagatcttcaggaaggggaaggtgtttgactacaat
ggacccagagagaagtatggcatcgttgaccacatggtcgagcagtcaggtcctccctcc
aagcaggtccaggcagctaaacaggtgcaggagctcatcaaggatggagacgatgcagta
atagttggcatcttctccagcgaacaggacgccgcttttgagatctacatcgaggcctgt
aacgcattgagggaagatttcaccttccgtcacacattcaactctgaagtgtccaaccta
ctgaaagcgtcacctggtcaggttatgattgttcagcctgaaaagtttcgatcgaaatac
gagcctgcgtctcacacactggcaataaaggatgacacgctggtgtctgaagtacaggag
ttcttcaaaaaaaatgtgatccctctagtgggccaccggaaacctagcaatgatgctaag
cgctacaccaaaagacctctggttgtcgtgtactatggagttgatttcagctttgactac
aggaaggctacacaattctggaggtccaaggtgttggaggtggccaaggacttccctgag
tacgtgttcgccatcgccgacgaagaggactacggagaagagctgaagagcctgggcctg
agtgagagcggtgaggaggtgaatgtagggattctggaggatggaggcaaaaagtttgcc
atggagcctgaggagctggacgcagacgtgctcagagactttgttatggcgttcaagaaa
ggtaaactcaagcccatcatcaagtcccagccagtaccaaagaacaacaagggaccagtt
aaagttgtggttggaaagacctttgatgagatcgtcatggatactcaaaaagatgtcctg
attgagttttacgcaccgtggtgtggccactgtaagaagttggagcctgactatttagct
ctggccaagaaatataaaggggagaaaaacctggtaatagccaagatggatgccacagcc
aacgacgtgccgaacgatggctacaaagtggaaggattccccacgatatactttgcaaca
agtaacagcaaacagacccccatcaaatttgagggtggagacagaacactggaggggttc
agcagtttcttggaaaagcacgccacaaagctttcacagaaagatgaactttga

DBGET integrated database retrieval system