KEGG   Takifugu rubripes (torafugu): 101064353Help
Entry
101064353         CDS       T02386                                 

Definition
protein unc-13 homolog A-like
Orthology
K15293  
protein unc-13
Organism
tru  Takifugu rubripes (torafugu)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 1784 aa AA seqDB search
MVVENAIHRAGSSNSKAVSAKQLSVSLKKAKLDGPQEKFNTYVTLKVQNVKSTTIAVRGS
QPCWEQDFMFEINRLDLGLTVEVWNKGLIWDTMVGTLWIPLRSIRQSNEEGPGQWVTLDS
NAIMAENEVCGTKDPTFHRLLLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDYAYQEE
QERPLHAPSTQCCNWSLWGDQPNEDPDSAADDRDSDYRSETSNSIPPPYYTTSQPNASMH
QYPMRQQHYRRPYDDEIHELDYGDHRAMSPTDSRYASSGELSRGSSQLSEEFVPEDGESL
RGSEFYDENDSYHSCHSSVSYGKEDSPGWDGDDPQGMYSDEGGYLRDGGEEGALYAEEEG
DLYAEYNYEDEEEMPYEEDEDMYPLDGTMSEEQEPPYTPTPTSTAPTLVPPSDSALTTRP
PLEKQASLHQQQPTHDHLHPPSMGTGQLPVKQEDQLHPFPTDSSTIPFTPAQTDLSTPTT
HTPAAVPQPPTPDTEPPEPEPKPEPLQVEPQALEQTPEGKSSPPAPEEKPEEPPVPSFPK
REMREPGPARAKANWLRLFSRVRLQLQEARGESVGIASLLLSAGMGGALYSIDSMPDLRK
RKAMPLVSDLSLVQNSRKAGITSALTSSTLHNEELKSHVYKKTLQALIYPISCTTPHNFE
VWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAE
DRTQNIIMVLKDRMKIRERNKPEIFELIQEVFTVIKATHVTQMKQIKQSVLDGTSKWSAK
ISITVLCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEETFNFECHNSSDR
IKVRVWDEDDDIKSRVKQKFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGA
IRMHINVEIKGEETVAPYHVQYTCLHENLFHFVTDIQNNGVVKIPDAKGDDAWKVYFEET
PQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTQATNN
VSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSI
TFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSREYQTNPAKQGPVPPE
EQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWNLFAQDMK
YAMEEHEKNRLCKSADYMNLHFKVKWLYNEYCKDLPFFKSRVPEYPAWFEPFVIQWLDEN
EEVSRDFLHGALERDKKDGFQVTSEHALFSCSVVDVFSQLNQSFEIIRKLECPDPQIVGH
YMKRFAKTISNVLLSYADIISKLFANYVSMEKVPCILINNIQQLRVQLEKMFEAMGGKDL
CVEASDILKDLQVKLNNVMDDLSRVFAVSFQPHIEENVKQMGDILAQVKGTSNVGNASSV
AQDADNVLQPIMEFLDSNLSLFAKICEKTVLKRVLKELWKLVMNTMEKTIVLPPLTDQTG
RLKSASHSDGTQLIFNAAKELGQLSKLKEHMVREEAKALTPKQCAVIELALDTIKQYFHA
GGVGLKKTFLEKSPDLLSLHYALSLYTQATDKLIKTFVQSQNAQGSGVEDAVGEVSIHVE
IFTHPNTGEHKVTVKVVAANDLRWQTQGIFRPFVEVFIIGPHLSDKKRKYATKSKNNSWA
PKYNETFTFTLSNEVGPECYELQVCVKDYCFAREDRTVGMAVLQLKDVASKGSVACWLPL
GKRIHMDETGLTVLRILSQRNNDDVAKEFVKLKSDQRSAEEGRS
NT seq 5355 nt NT seq  +upstreamnt  +downstreamnt
atggtggtagagaatgctattcacagagctggcagctccaacagcaaggctgtttcagcg
aagcagctgagtgtaagcttgaagaaagccaagctcgatggaccacaagagaaatttaac
acatacgtgaccctgaaggtgcagaatgttaaaagcaccacaatcgccgtgcgtggcagc
caaccatgttgggagcaggattttatgttcgaaataaaccgccttgatctgggcctgacg
gtggaggtgtggaataaaggactgatctgggacaccatggtgggcaccttatggataccg
ctgcgcagcatacggcagtccaatgaggagggtccgggtcagtgggtcaccttggactcc
aatgcaatcatggctgagaatgaagtgtgtggaaccaaagaccccaccttccatcggctg
ctgctcgacacccgctttgaactgccactagacattcctgaggaagaggccagatactgg
gccaagaaactcgaacaactcaatgccatgagagatcaagattatgcctatcaggaggaa
caggagcgaccgctccacgcaccatctacacaatgctgtaattggagcttgtggggagat
cagccaaacgaggacccagacagtgctgcagacgacagggacagcgactaccgcagcgag
accagtaatagcattcctcctccctactacaccacctcccagcccaacgcttccatgcac
caatatcccatgaggcaacagcactacagacgcccctatgatgatgaaatccatgagctg
gactacggcgaccatagagccatgagcccgacagacagccgttacgcctcctctggcgag
ttaagtcggggtagctctcagctcagtgaagaatttgttcccgaggatggtgagagcctg
cgcggttcagagttctatgacgagaatgattcctaccactcctgccactcctctgtcagc
tacggcaaagaggattcgccgggatgggacggtgatgatccccaaggcatgtacagcgac
gagggaggttacctcagagacggaggggaagagggagctctgtatgcagaagaggagggg
gacctgtatgcagagtacaattatgaggatgaggaggagatgccttatgaggaagatgaa
gatatgtatccacttgatggcacaatgagcgaagagcaggagccaccctatacaccaaca
cccacaagcaccgcccccaccctggtgcccccctctgatagcgcactgaccaccaggcca
cctttggaaaaacaggcatctttgcatcagcagcagcccacccatgaccatctccacccc
cccagtatgggtactggtcagcttccggttaagcaggaagaccagctacatcctttcccc
acagactcttccacgattccattcacacctgcccagaccgatctgtccacacccaccaca
cacacccctgctgctgtgccacagcccccaactccagatacggagcccccggagcctgag
cccaagcctgagccgctgcaggtggagcctcaggccttagagcagacccctgaagggaag
agtagccctccagctcctgaggagaaaccagaggagccacctgtaccgagcttcccgaag
agagaaatgagggaacctggtcctgctagagccaaagctaactggctacgacttttcagc
agagttcgactacagctgcaagaggctcgaggggagagcgttggaatcgcctctctgctt
ttatcagcaggaatgggcggtgctctgtacagcatcgacagcatgccagacctcaggaag
agaaaggctatgcctctggtcagtgatctgtccttggttcagaattctaggaaggcggga
ataacatctgccctgacatccagcaccctacataatgaagaactgaagtctcacgtctac
aagaagaccctccaggcactcatatatcctatctcgtgcacgaccccacacaatttcgag
gtgtggacagccacaacgcccacttactgctacgagtgtgagggacttctgtggggtatt
gctcgccagggcatgcgctgtactgagtgtggcgtcaaatgccacgagaagtgccaagat
ctactcaacgctgactgtctgcagagagcagctgagaagagctccaaacacggcgcagag
gatcgaacccagaacattatcatggttcttaaagaccgtatgaagatccgtgagaggaac
aaaccagagatctttgagctcattcaggaagtgttcaccgtcatcaaggctactcatgta
acccaaatgaagcagatcaagcagagcgtgctggacggcacctctaagtggtcggccaag
atcagcatcacagttttgtgtgcccaaggtcttcaggcgaaggataaaaccggctccagt
gacccatatgttactgttcaggtggggaagacgaaaaagaggaccaagactatctatggc
aacctcaaccctgtttgggaggagacatttaatttcgaatgtcacaactcctcagaccgg
atcaaggtacgtgtgtgggatgaagatgatgacatcaagtctcgagtgaagcagaagttc
aaacgggagtccgacgacttcctgggccaaactattatcgaggtccgcaccctgagcgga
gagatggacgtctggtacaatctggacaagcggacagacaaatcagcggtgtctggagcg
atacgcatgcacattaatgtggagatcaaaggagaggagacggtcgccccctatcatgtt
cagtacacctgtctgcatgaaaaccttttccactttgtgacagatatccagaacaatggc
gtggtgaagatccccgatgccaaaggtgatgatgcttggaaagtctattttgaggagact
cctcaggagatcgtggatgagtttgccatgcgttatggagtggaatccatctaccaggcc
atgacgcactttgcctgcttgtcatccaagtacatgtgcccgggtgtgccagccgtcatg
agcactttactggccaacatcaacgcctactacgctcacaccacccaggcaaccaacaac
gtctctgcctctgaccgctttgctgcctccaactttggaaaggagcggtttgtcaaactt
ctagaccagctgcacaactctctaaggatcgacctgtccatgtacagaaacaatttccct
gccagcagtcccgagagactccaggacctgaaatctacggtggacctcctcaccagtatc
accttcttcaggatgaaggtccaagagctccagtccccacccagagccagtcaggtcgtc
aaagactgcgtcaaagcttgtctcaactccacctacgagtacatcttcaataactgtcac
gagctgtacagccgcgagtatcagacgaatcccgccaaacagggccctgtgcctccagag
gagcaggggccaagcatcaagaacctggatttctggtccaaactcatcacccttatcgtc
tccattatcgaggaggacaagaactcatatactccctgtctaaaccaatttcctcaggag
cttaatgtggggaaaatcagtgctgaagtgatgtggaacctgtttgctcaggatatgaaa
tatgcaatggaggagcatgaaaaaaatcgtttgtgcaagagtgcggattacatgaaccta
cacttcaaggtcaagtggctgtacaatgagtactgcaaagacttacctttcttcaagagc
agagtgccagaatatcctgcttggtttgagccttttgtcattcagtggttggacgaaaac
gaggaagtgtctcgagatttccttcatggcgctttggagagagacaaaaaagatgggttc
caggtcacatcagaacacgccctgttctcctgttccgtcgtggatgtgttctcccagctt
aaccagagctttgagattatcaggaagctcgagtgtcccgatccacagatcgtggggcac
tacatgaagcgatttgctaagaccatcagcaatgtccttttgtcttatgcggacatcatc
tctaaattgttcgccaactatgtcagcatggagaaagtgccctgcatcttgataaacaac
atccagcagttgagggttcagctggagaagatgtttgaagccatgggagggaaagatctg
tgtgtggaggcgagcgacatcctgaaagacctgcaggtgaagctcaacaacgtcatggat
gatctcagcagagtctttgctgtcagcttccagccgcacatagaagagaatgtgaagcag
atgggagacatcttggctcaggtgaagggaacctcaaacgtgggcaatgccagcagcgta
gcccaggatgctgacaacgttctgcagccaatcatggagttcctggatagcaacttgtcc
ttgtttgccaagatctgtgagaagactgtgctgaagcgcgtgctgaaggagctgtggaag
ctggttatgaacaccatggaaaagaccatcgtcctgccgccactcacagatcaaacaggg
aggctgaagagtgcttctcacagtgatggcactcagctcatctttaatgctgcaaaggag
ctgggacagctgtccaagctgaaggagcacatggttcgtgaagaggccaaagcactcact
cctaagcagtgcgctgtaatagagctggcgctggatactatcaagcaatatttccatgct
ggcggcgtcggattgaagaagactttcctggagaagagtcctgacctgctgtctctgcac
tacgccctgtcgctttacacccaggctacagataaactcattaagacctttgtccagtcg
cagaacgcccaaggctcgggggtggaggatgctgtgggagaggtgtccattcatgtggag
atcttcactcatcccaacactggagagcacaaggttacggtcaaagtggtggccgccaac
gacctgcgttggcagactcaggggattttccgtcctttcgtggaggtcttcatcatcggc
ccccacctgagcgacaagaagaggaagtacgccaccaagtccaagaacaacagctgggcc
ccaaaatacaacgaaacgttcaccttcaccctgagcaacgaggtgggtcctgagtgctac
gagctccaggtgtgtgtgaaggactactgcttcgcccgggaggaccgcacggtgggcatg
gctgtcctgcagctgaaggatgtggcctccaagggcagcgtggcctgctggctgccgctg
ggcaaacgcatccacatggacgagaccggactgaccgtcctgcgcatcctgtcccaacgt
aacaacgacgacgtggccaaggagttcgtcaagctcaagtccgaccagcgctctgcagag
gagggccgcagctaa

DBGET integrated database retrieval system