KEGG   Takifugu rubripes (torafugu): 101064444Help
Entry
101064444         CDS       T02386                                 

Definition
TNF receptor-associated factor 2-like
Orthology
K03173  
TNF receptor-associated factor 2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tru04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tru04010]
Cellular Processes; Cell growth and death; Apoptosis [PATH:tru04210]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:tru04622]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:tru04920]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:tru05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 501 aa AA seqDB search
MATQEPSPPSSMESNKPGFPKKILGNKLEDKHLCNCCHNILRRPFQAQCGHRFCSYCFNR
TVSNGPQKCSACIKEDIFEDPTSILKQGCAFPDNAVRREVEHLPAACINENCTWKGTIKE
YELNHEGKCEFMIISCPSCKEHIRFNEQERHNERECPERTLNCKYCKEPFHFKNIKAHDE
ICPKYPMICEGCAKKKIPREKYVDHIKFCSKFRTPCRFHVVGCDMSVEKEKIHDHERAYA
YEHLNLLLHYIMGMKLQLHSEKTKVAELGRRCTELEVKANTFENVVCVLNREVERFATTM
EASNRQHKLDQDKIEALSNKVRQLERTVGLKDLTVAEMEGRLREMSATTFDGVFVWRISD
FAKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGSHLSLFFVVMRGQSDA
LLKWPFNQKVTLMLLDQSNREHIIDAFRPDVTSSSFQRPVSEMNIASGCPLFCPLSKLDG
KNSYIRDDTIFIKAIVDLTGL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggccacacaggagccgtcccctccttcgtccatggagagcaacaagcccggcttcccc
aagaagatcctgggcaacaagctggaggacaaacacctgtgcaactgctgccacaacata
ctcagacgaccgttccaggcccaatgtggacatcgcttctgctcctactgcttcaacaga
acagtgagtaatggaccccagaaatgcagtgcctgcattaaggaggatatttttgaggat
cctacatcgattttgaaacaaggatgtgcttttcccgacaacgccgttcgaagggaagtc
gaacaccttccggccgcgtgtatcaacgaaaactgcacctggaaaggaaccattaaagaa
tatgagctcaaccacgaggggaagtgcgagttcatgatcatctcttgtccctcctgcaaa
gaacacatccgcttcaacgagcaagagcggcataacgagcgcgagtgcccggagaggacg
ctcaactgcaaatactgcaaggaacccttccacttcaaaaacatcaaggcgcatgatgag
atctgtcccaagtacccgatgatctgcgaaggctgtgcaaaaaagaagatccccagggaa
aagtatgtggatcatatcaagttctgcagcaaattcagaacgccgtgtcgatttcacgtc
gtggggtgtgacatgtctgtggaaaaggaaaaaattcacgaccacgagcgcgcctacgca
tacgagcacctcaacctgttgctgcattacatcatgggcatgaaactgcagctccacagc
gagaagaccaaggtggccgagctagggcgccggtgcacagagctggaggtcaaagccaac
acctttgagaacgtggtgtgtgtgctgaacagagaggtggagaggttcgccaccaccatg
gaagccagcaaccgtcagcacaaactggaccaggacaagatcgaggctctgagcaacaag
gttcgacagctggagaggacggtggggctgaaggacctcaccgtggctgagatggagggc
cggctgagggaaatgtctgccacaacctttgacggcgtctttgtttggcggatctctgat
tttgccaagaagaggcaagacgccatcgcgggtcgcgctcctgccatgttttcaccagcc
ttctacaccagtaagtacggctacaagatgtgcttgcggatctacctgaatggagacggg
acggggcgcggcagccacttgtccctgttctttgtggtcatgaggggacagagtgacgct
ctgctcaaatggccgttcaaccagaaggtgaccctcatgctgttggaccagagcaacagg
gagcacatcatcgacgcctttcgccccgacgtcacttcctcctcctttcagagacccgtg
agcgagatgaacatcgccagcggctgcccgctcttctgcccgctctctaagctggatggg
aagaactcctacatccgcgacgacaccattttcatcaaggccatcgtggacctcaccggc
ctctag

DBGET integrated database retrieval system