KEGG   Takifugu rubripes (torafugu): 101064544Help
Entry
101064544         CDS       T02386                                 

Definition
early endosome antigen 1-like
Orthology
K12478  
early endosome antigen 1
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Endocytosis
Phagosome
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101064544
   04145 Phagosome
    101064544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 1391 aa AA seqDB search
MLRRILQMTPGKGGSQNAESEPPSADLNHDQTSEGFICPQCMKSHNSAEELFKHYDLFHD
TGELPAHVAPTREDLTMLRQEVQDLHASLKEERWFSGELKKELDKVQGHLKQSDGQTDPA
ESALERKLNEAETEKFNIKQMKDLFEQKAAQLATEIVDLKSRLDEEKSLREAADHKLAKL
TEQLQKEKQENDRLQTELLQRPGVEDVEVLQKELVQVQTLMDSMSREREEESERLKTHYE
ELEANHINAEMTISQLKAELEKGPQEVAVYTKEIHELKSSLNSLQQQSQSLSEKLARKEK
EHLQLKEMLATETTTKKNVQDGLREREQEVQELQSRVIGAEASLQKARADLQERSEEVAK
LKIEMGELEVKHAELKVERKQLEQQREEKESHGAQQQTEISQLHAKLLETERQLGEVEGR
LKEQRQLSGEKLKDREQQAADLQLKLSRTEEQLKESATKNTDLQHQLEKAKQQHQELQVL
QQNTNGKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKDIVSQLEAERDDLCAKIQAG
EGETAVLNQLKEKNQALQGQVTQLTDKLKNQSESNKQAQDNLHKQVQEQKTLLRSAQDRA
HTMETTVTELTAQLTDSKEKVSQLDAQLKAKTEMLLSAEAAKAAQKANMENSLETAQHAL
QDKQQELNKVQKKIEEQAQSLKEKREQCTQLETNLKEYKDKVLSSEQHVEQLQSLNKRLE
SQLGELQTTHEQVQQEVQNLQKEGTEMKQKAKELHHSLETEKEGVRSLKEEIKTKTTALT
DVQQQLKCSEQDRATLTMNLDKINQEQTKLNSKLQNLMADLQKAQQEKEAHKKEVGSLQE
NLANNKKALKESQNALDAERKTHKSAVEEREKSNEKARQELLKKNEALTKAVNDSKEQLE
QLREAEKRLKVQLTSAEQQHLKAQEGLKEKQNQLEKLQAQLKTVQGNFEMETKKLKGQIA
ELQENGAKKAEEESQLRMQVSGLSEELTSEKCRTTELQQALEQSQESHSKLQSDFYGKES
EVSALHQDLKASEEKLKLAQEELAGNQTYQTGLEAQIKELQVARSSLEQELEKRNQKLQQ
QEQTLNDSEKQQSQVMEELRKEKSKVEELNKVQNDLEKNNTRLIKDVTALKEKGQKELGE
LQEAKQLLIQQKLELQTRVEAAQDDLEQERTEHQATKDSILQQKEQFLAQIKDMQDKLLA
EKKAKEEQVKRGEEAEAKLNVQVTALNENVATLKREWQSSQRRVGELEKHTDELRGEIAV
LEATVQNNQDERRALLERCVKGEGEIEKLQAKVVELRRKLEDTTAAMQELGRENQSLQIK
QSQSLTRKWTEDNEVQNCMACGKGFSVTVRKHHCRHCGNIFCAECSSRNALTPSSKKPVR
VCETCFEELQG
NT seq 4176 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggcggatacttcaaatgacccctgggaaggggggttctcagaatgcagaatca
gagccacccagcgcagacctgaatcatgatcaaacatcagagggcttcatctgtcctcag
tgcatgaaatctcacaactctgcagaggagctttttaagcactatgatctgttccatgat
actggagaattacccgctcacgtggcccccactcgggaagaccttacaatgttgcggcag
gaggttcaggacttgcacgcatctctcaaggaggaacgatggttctctggagagctaaag
aaggaattagacaaagtccaggggcacctgaagcaaagtgatggacagacggacccagct
gaatcagcccttgaaaggaagttgaatgaagcagaaactgagaagtttaacatcaagcag
atgaaagacttgtttgagcagaaggctgcccagctggccacagagatagtagacctaaag
tcccgccttgatgaagagaagagcctccgggaggctgctgaccacaaactggctaaactt
acggaacagctgcagaaagagaagcaggagaacgacagactccaaacagagctgctgcaa
cggcccggtgtggaggatgtggaggtgctgcagaaggagctggtgcaggtgcagacattg
atggacagtatgtctcgtgagagggaagaagagtctgaacgtctcaaaacccactacgaa
gagctggaggcaaatcacattaacgcagagatgaccatttcccagctgaaagcagagctg
gagaagggtccacaggaagtagctgtctacacaaaagagattcatgagctgaagagcagt
ctgaacagtctgcagcagcaaagccagagcctgtcagaaaagcttgcacgtaaggagaaa
gagcatctgcaactgaaggaaatgttagctacagagaccaccactaagaagaatgtccaa
gacggtctgagggagagggagcaggaggttcaagagctacagtctcgggtcattggggct
gaggcttctctgcagaaggcccgggcagatctccaagagaggagtgaggaagtggcaaag
ctgaagattgagatgggggagctggaggtgaagcatgcagagctgaaggttgaacgaaaa
cagttggagcagcaaagggaagaaaaagagagtcatggagcacagcagcagactgagatc
agtcagctgcacgccaaactgctggagacagagcggcagctaggcgaagttgaaggtcgt
ttgaaagaacagaggcagctgtcgggggagaaattaaaggaccgcgagcaacaagcagct
gacctccaactcaaactgtctcgtacagaggagcagttgaaggaaagtgccactaagaac
acagacctgcagcatcaactggaaaaagccaaacagcagcaccaggaactgcaggtgttg
cagcaaaacacaaacggcaaactccgggaggcccagaatgacctggagcaagtcctgcgt
cagattggggataaggaccagaagattcagaatctggaggcactgctacagaagagcaaa
gacattgtgagccagctagaggctgagagagacgacctatgtgccaagatccaagccggc
gagggggaaacggccgtgctcaaccagcttaaagagaaaaaccaggcattacaaggacag
gttacacagctgacagacaaactgaaaaaccaatctgaaagcaacaagcaagctcaggat
aatctccacaagcaggtccaggagcagaagaccttgttgcgctccgcccaggaccgagcc
cataccatggagactacagtcactgagctcactgctcaactcactgacagcaaggagaaa
gtgtcccagctagatgctcagttgaaagccaaaacagaaatgctgctctccgctgaagct
gcgaaggctgcacagaaagccaacatggagaacagcctggagactgctcagcatgctttg
caggacaagcagcaggagttaaataaggtgcagaagaagatagaggagcaggcccaaagc
ctcaaggagaaaagggagcagtgcacacagctagaaaccaacttgaaggaatacaaagac
aaggtattgtcttcagagcagcacgtcgaacagctacagagcctcaataagagactggag
tcacagcttggggaactgcagactacacatgagcaggtgcagcaagaagtgcagaacttg
cagaaggaaggcacagagatgaaacagaaggctaaagagcttcatcactcgttggagacg
gagaaggaaggggttagaagtctaaaagaggaaataaagacaaagacaactgctttgact
gatgttcagcagcagctgaaatgctccgaacaggacagagctactcttacaatgaacctg
gacaaaatcaaccaagagcaaacaaagctaaacagtaaacttcaaaacctcatggcagat
ttacaaaaggcccagcaggagaaagaggctcacaagaaggaggttggctccttgcaggag
aacctagcaaacaataaaaaggccctaaaagagagtcagaatgcactggatgctgagagg
aagacccataagtcagcggtggaggagagagaaaagtccaacgagaaggccagacaggaa
cttcttaaaaagaacgaggccctgaccaaggcggtgaacgactctaaagagcagttggag
cagctgagggaggcagagaaaagattgaaagtacagttgacttcagcggagcagcagcac
ttaaaagctcaggaggggctaaaggaaaagcagaatcagttggagaagcttcaagcacaa
cttaagactgtacaagggaactttgagatggagacaaagaaactaaagggccaaatagca
gagttgcaagaaaatggtgccaaaaaggcagaagaagaaagtcaacttcggatgcaggtg
tcaggactgagcgaagaactaacttccgagaagtgtcgcacaacagaactgcaacaggct
ttggaacaaagccaggaaagtcacagcaagctgcagtctgacttttacggcaaggagtct
gaagtgtctgcactgcatcaagacctgaaggcctctgaggagaagctgaaacttgcccag
gaggagctggctggtaatcaaacctatcagacaggtttagaagctcaaatcaaggagcta
caagtggctcgaagctcgctggagcaagagttggaaaaacgaaaccagaagctccaacag
caggagcaaactttaaacgattctgagaagcaacagtctcaagtgatggaagaactgaga
aaggagaagagtaaagtggaggagctaaataaggtccagaatgacttggagaagaacaac
acacgactgattaaagatgtaacggcactaaaggagaaagggcaaaaggaactgggtgaa
ctacaggaagccaaacagctgctgattcagcagaagttggagcttcagactcgggtggaa
gcggcacaagatgatctggagcaggagaggacggagcatcaggccactaaagacagcatt
ctgcaacaaaaagagcagttcctcgcccaaattaaagatatgcaggataaattgttggct
gagaagaaagccaaagaggagcaggtgaagcgtggcgaggaggcagaagccaagctgaac
gtgcaggtgacggccctaaatgaaaacgtggccacattgaagagagagtggcagagcagc
cagcggagagtcggggagctggagaagcatacggatgagctgagaggagagatcgctgtg
ctggaggccaccgtccagaacaaccaggatgagagacgggcacttctagaaaggtgtgta
aagggtgaaggtgaaatcgagaaactgcaggccaaagtggtggagctgaggaggaaactg
gaagacaccacagcagccatgcaggagctcggcagagagaaccagtcactccagattaag
cagtcccagtctctgaccagaaagtggacggaggataacgaagtgcagaactgcatggcc
tgtgggaaaggcttttctgtcactgtcaggaagcaccactgcagacattgcgggaacatt
ttctgcgctgaatgttcatcgaggaacgccctcacaccgtcctccaaaaagccagtcagg
gtctgcgagacctgcttcgaggagctccaaggctga

DBGET integrated database retrieval system