KEGG   Takifugu rubripes (torafugu): 101064560Help
Entry
101064560         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 8-like
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101064560
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101064560
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101064560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 1082 aa AA seqDB search
MPSVSSGVKELYLSTSLGDLNKKAEVKPEKTSTRSYVQSACKIFKAAEECRLDRDEERSY
VLYMKYLTVYDIIKKRPDFKKQMDYYMTLLGPSSFKKAIEEAEKLSGSLKLRYEEVEVRK
KLEEKERQEEKQKKEEITEKDSGQSSPKASAANKDSKKIKGEQNQLKTSTSKAGGITAEK
LFHMMKDQTITVIVMDARCQKDFEESHIQVPPQTCISVPEEAITPGITVNQIETKLPDVS
KDKWSHRGFVDYIVLLDWFSSVTDLELGTTLKSLKDALFKWDSITILRSEPLVLEGGYEN
WLLFYPMYTTNAKVHPPRQNIISTLPQLTFSYPSLEEPKPPVALKPEPDVEAVLQEPSVP
VLVNGIVPAESSSSKTSVVAQSLPDTVDSPVTSSTNSGPDLSKMGPVAGVSNQTATTAKA
FPQFDRAKKPSVHVSDEPKHSLNGSAKESTQNGPVVPDRSVKPSFVPPASLSKEEQSQIH
SEAIAVMEKAKQEQEKRNQLRRSEEERREKEEKYQQKERLQREEGENGKKEEEERGHQER
KKLERQKAEEEEDKGSKVWEGKEKRGKEQSSDTPSKSMSLDSPAPHHVVSEIKREPLTRA
RSEEMGRTVPGLPDGWMKFLDTVTGTYRYYHSPTNRVHLYPPEVTVPQTPPSTPPTAKQK
APQPDASREREREQSKLKRSYSSPDISQDLREEAQKKAVAPTTAAVIPTINRDTKPAPAK
VYSKVEIARPSAAKIRSLNPSFGGLGASLTGLRNLGNTCYMNSVLQCLCNAPALTEYFNN
NYYMDDINRSNILGHKGDVAEEFGVIMKALWSGLYKCISPRDFKITIGKINEQFSGYEQQ
DSQELLLFLMDGLHEDLNKADNRKRYKEEENDHLDDQTAADVAWRKHKLLNESIIVALFQ
GQFKSTVQCLTCHRKSRTFETFMYLSLPLASTSKCSLQDCLRLFSKEEKLTDNNKVFCRH
CKAHRDSTKKLEIWKVPPILLVHLKRFSYEGRWKQKLQTSVDFPLDSLDLAQYVIGPKQS
LKRYSLYAVSNHYGGLDGGHYTAYCKSALKQRWYKFDDHEVSDISTSSVKSSAAYILFYS
TL
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagtatcttccggggtcaaggagctgtatctgtccacatctctgggggacctc
aataaaaaggctgaagtaaagccagagaagacaagcaccagaagttatgtccagagtgcc
tgcaaaatctttaaggcggctgaggagtgccgtctggacagagatgaggagagatcatac
gtgctgtacatgaagtatttaacagtatatgacataatcaagaaaagaccagacttcaag
aaacagatggattactacatgaccctgcttgggccaagcagctttaaaaaagccattgaa
gaagctgagaagttgtctggaagccttaaactcagatatgaggaggtggaggtaagaaaa
aaactggaggagaaagagagacaagaagagaagcaaaagaaggaggaaataacagagaaa
gatagtggtcaaagttctccaaaagcatcagcagcaaacaaggacagcaaaaagatcaaa
ggagaacagaatcaactcaagacttcaacctcaaaagctggtggcatcactgctgagaag
ctgttccacatgatgaaggatcagacaataacagtaattgtcatggacgcgcgctgccaa
aaagattttgaagagtctcacatacaggttccaccccagacctgcatctctgtgcctgag
gaggcaattactccaggaatcactgtgaatcaaattgaaacaaagttgccagatgtatcc
aaagacaaatggagccatcgggggtttgtggattatatagtccttctggattggttcagt
tcggtaacagaccttgaacttggtacgaccttgaagagcctcaaagatgccctctttaag
tgggacagcatcaccatcctgcgcagtgagccgttggttttggagggaggatatgagaac
tggctgctgttttatcccatgtacacaacaaatgctaaagtgcaccctccaagacagaac
atcatcagtaccctccctcaattgacttttagttacccctctttagaggaaccaaagcct
cctgttgcactcaaaccagaacctgatgttgaagcggtccttcaggagccctctgttcct
gtgctggtaaatggcatagtcccagcagaatcctcctcttctaaaacctcagtggttgct
cagagtttgccagacactgttgattcccctgtcacgagctccacaaattctgggccggac
ctcagtaagatggggccggttgcaggcgtgtccaaccagacagcgacaacagccaaggct
ttcccacagttcgaccgtgccaagaaaccttcagtccacgtttcggacgaacctaagcac
agtctaaatggatctgcaaaggagtcgacccagaatggcccagttgtccctgatcgctca
gtcaaaccgtcctttgttccgccagcctctctgtctaaagaagaacagagtcagatccac
tcagaggccattgcggtgatggagaaagcaaagcaagagcaggagaaacgcaaccagttg
cggcgctcagaggaggagaggcgggaaaaggaagagaagtatcagcagaaagaaagactg
caaagagaagaaggggaaaatggcaagaaggaagaggaggagagggggcatcaggagaga
aagaagttggagcgacagaaggcggaagaggaggaggacaaaggcagcaaagtgtgggag
ggaaaagagaagaggggaaaggagcagagctctgacacaccctcaaagagtatgtccctt
gactctcctgctccacatcatgttgtcagtgaaatcaagagggagcccttgacgagagct
cggagtgaggagatgggtaggactgtacctggccttccagacggctggatgaagtttctc
gacactgtgacggggacctaccgatactaccattcccctaccaatcgtgtccacctttac
ccccctgaagtcaccgttccccagaccccgccgtccaccccaccgacagccaagcagaaa
gcaccgcagccagatgccagccgtgaacgagagcgggagcagtctaaactgaaacgttcc
tactcctcccctgacatcagtcaagacttgagagaggaggcccagaagaaggcggtcgct
ccaaccaccgctgctgtcatacccacaatcaacagggacaccaaacccgcccctgccaaa
gtctactccaaagttgaaattgcacgaccatcagcagccaaaattcgcagcttgaatcct
tctttcggggggctgggtgcgtcactgactggcctgcgtaaccttggaaacacatgctac
atgaactccgtcttgcagtgtttgtgcaatgctcctgccttgactgagtacttcaacaac
aactactacatggatgacatcaataggtccaacatccttggccataaaggggatgtggca
gaagagtttggggtcatcatgaaagccttgtggtctggtctatacaagtgcatcagcccg
agggacttcaagatcaccattggaaagatcaatgagcagttttctggttatgaacaacag
gactctcaggagctgctgctcttcctcatggacgggctccatgaggacctcaacaaggcg
gacaaccgaaagcgatacaaagaggaggaaaatgaccatctagatgatcagactgcagca
gacgtggcctggaggaaacacaagctgttgaatgagtccatcattgtggcgctgtttcag
ggccagttcaaatccactgtgcagtgtcttacctgccatcgcaagtcacggacgtttgag
acctttatgtacctgtcgctgcctctggcttccaccagcaagtgttccctgcaggattgt
ctgaggttgttctccaaggaagagaagctgactgacaacaataaggtgttctgcagacac
tgcaaagcccacagagactccaccaagaaactggagatctggaaggtcccacccattctg
ctggtgcacttaaaacggttttcctatgagggcagatggaaacagaagctgcaaacgtct
gtggatttcccattagacagtctggacctggcccagtatgtcattggacccaaacagagc
ctgaaaagatacagcctttatgcggtttcaaaccactatgggggtttggatggtggccat
tacacagcctactgtaagagtgcccttaaacagcgctggtacaagtttgatgaccacgag
gtgtctgacatctccacctcctcggtcaagtcctccgcagcctacattctgttttactcc
accctgtga

DBGET integrated database retrieval system