KEGG   Takifugu rubripes (torafugu): 101064560Help
Entry
101064560         CDS       T02386                                 

Gene name
usp8
Definition
(RefSeq) ubiquitin specific peptidase 8
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101064560 (usp8)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101064560 (usp8)
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101064560 (usp8)
Ubiquitin system [BR:tru04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101064560 (usp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
13
AA seq 1086 aa AA seqDB search
MPSVSSGVKELYLSTSLGDLNKKAEVKPEKTSTRSYVQSACKIFKAAEECRLDRDEERSY
VLYMKYLTVYDIIKKRPDFKKQMDYYMTLLGPSSFKKAIEEAEKLSGSLKLRYEEVEVRK
KLEEKERQEEKQKKEEITEKDSGQSSPKASAANKDSKKIKGEQNQLKTSTSKGSVPAGGI
TAEKLFHMMKDQTITVIVMDARCQKDFEESHIQVPPQTCISVPEEAITPGITVNQIETKL
PDVSKDKWSHRGFVDYIVLLDWFSSVTDLELGTTLKSLKDALFKWDSITILRSEPLVLEG
GYENWLLFYPMYTTNAKVHPPRQNIISTLPQLTFSYPSLEEPKPPVALKPEPDVEAVLQE
PSVPVLVNGIVPAESSSSKTSVVAQSLPDTVDSPVTSSTNSGPDLSKMGPVAGVSNQTAT
TAKAFPQFDRAKKPSVHVSDEPKHSLNGSAKESTQNGPVVPDRSVKPSFVPPASLSKEEQ
SQIHSEAIAVMEKAKQEQEKRNQLRRSEEERREKEEKYQQKERLQREEGENGKKEEEERG
HQERKKLERQKAEEEEDKGSKVWEGKEKRGKEQSSDTPSKSMSLDSPAPHHVVSEIKREP
LTRARSEEMGRTVPGLPDGWMKFLDTVTGTYRYYHSPTNRVHLYPPEVTVPQTPPSTPPT
AKQKAPQPDASREREREQSKLKRSYSSPDISQDLREEAQKKAVAPTTAAVIPTINRDTKP
APAKVYSKVEIARPSAAKIRSLNPSFGGLGASLTGLRNLGNTCYMNSVLQCLCNAPALTE
YFNNNYYMDDINRSNILGHKGDVAEEFGVIMKALWSGLYKCISPRDFKITIGKINEQFSG
YEQQDSQELLLFLMDGLHEDLNKADNRKRYKEEENDHLDDQTAADVAWRKHKLLNESIIV
ALFQGQFKSTVQCLTCHRKSRTFETFMYLSLPLASTSKCSLQDCLRLFSKEEKLTDNNKV
FCRHCKAHRDSTKKLEIWKVPPILLVHLKRFSYEGRWKQKLQTSVDFPLDSLDLAQYVIG
PKQSLKRYSLYAVSNHYGGLDGGHYTAYCKSALKQRWYKFDDHEVSDISTSSVKSSAAYI
LFYSTL
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagtatcttccggggtcaaggagctgtatctgtccacatctctgggggacctc
aataaaaaggctgaagtaaagccagagaagacaagcaccagaagttatgtccagagtgcc
tgcaaaatctttaaggcggctgaggagtgccgtctggacagagatgaggagagatcatac
gtgctgtacatgaagtatttaacagtatatgacataatcaagaaaagaccagacttcaag
aaacagatggattactacatgaccctgcttgggccaagcagctttaaaaaagccattgaa
gaagctgagaagttgtctggaagccttaaactcagatatgaggaggtggaggtaagaaaa
aaactggaggagaaagagagacaagaagagaagcaaaagaaggaggaaataacagagaaa
gatagtggtcaaagttctccaaaagcatcagcagcaaacaaggacagcaaaaagatcaaa
ggagaacagaatcaactcaagacttcaacctcaaaaggttctgtgccagctggtggcatc
actgctgagaagctgttccacatgatgaaggatcagacaataacagtaattgtcatggac
gcgcgctgccaaaaagattttgaagagtctcacatacaggttccaccccagacctgcatc
tctgtgcctgaggaggcaattactccaggaatcactgtgaatcaaattgaaacaaagttg
ccagatgtatccaaagacaaatggagccatcgggggtttgtggattatatagtccttctg
gattggttcagttcggtaacagaccttgaacttggtacgaccttgaagagcctcaaagat
gccctctttaagtgggacagcatcaccatcctgcgcagtgagccgttggttttggaggga
ggatatgagaactggctgctgttttatcccatgtacacaacaaatgctaaagtgcaccct
ccaagacagaacatcatcagtaccctccctcaattgacttttagttacccctctttagag
gaaccaaagcctcctgttgcactcaaaccagaacctgatgttgaagcggtccttcaggag
ccctctgttcctgtgctggtaaatggcatagtcccagcagaatcctcctcttctaaaacc
tcagtggttgctcagagtttgccagacactgttgattcccctgtcacgagctccacaaat
tctgggccggacctcagtaagatggggccggttgcaggcgtgtccaaccagacagcgaca
acagccaaggctttcccacagttcgaccgtgccaagaaaccttcagtccacgtttcggac
gaacctaagcacagtctaaatggatctgcaaaggagtcgacccagaatggcccagttgtc
cctgatcgctcagtcaaaccgtcctttgttccgccagcctctctgtctaaagaagaacag
agtcagatccactcagaggccattgcggtgatggagaaagcaaagcaagagcaggagaaa
cgcaaccagttgcggcgctcagaggaggagaggcgggaaaaggaagagaagtatcagcag
aaagaaagactgcaaagagaagaaggggaaaatggcaagaaggaagaggaggagaggggg
catcaggagagaaagaagttggagcgacagaaggcggaagaggaggaggacaaaggcagc
aaagtgtgggagggaaaagagaagaggggaaaggagcagagctctgacacaccctcaaag
agtatgtcccttgactctcctgctccacatcatgttgtcagtgaaatcaagagggagccc
ttgacgagagctcggagtgaggagatgggtaggactgtacctggccttccagacggctgg
atgaagtttctcgacactgtgacggggacctaccgatactaccattcccctaccaatcgt
gtccacctttacccccctgaagtcaccgttccccagaccccgccgtccaccccaccgaca
gccaagcagaaagcaccgcagccagatgccagccgtgaacgagagcgggagcagtctaaa
ctgaaacgttcctactcctcccctgacatcagtcaagacttgagagaggaggcccagaag
aaggcggtcgctccaaccaccgctgctgtcatacccacaatcaacagggacaccaaaccc
gcccctgccaaagtctactccaaagttgaaattgcacgaccatcagcagccaaaattcgc
agcttgaatccttctttcggggggctgggtgcgtcactgactggcctgcgtaaccttgga
aacacatgctacatgaactccgtcttgcagtgtttgtgcaatgctcctgccttgactgag
tacttcaacaacaactactacatggatgacatcaataggtccaacatccttggccataaa
ggggatgtggcagaagagtttggggtcatcatgaaagccttgtggtctggtctatacaag
tgcatcagcccgagggacttcaagatcaccattggaaagatcaatgagcagttttctggt
tatgaacaacaggactctcaggagctgctgctcttcctcatggacgggctccatgaggac
ctcaacaaggcggacaaccgaaagcgatacaaagaggaggaaaatgaccatctagatgat
cagactgcagcagacgtggcctggaggaaacacaagctgttgaatgagtccatcattgtg
gcgctgtttcagggccagttcaaatccactgtgcagtgtcttacctgccatcgcaagtca
cggacgtttgagacctttatgtacctgtcgctgcctctggcttccaccagcaagtgttcc
ctgcaggattgtctgaggttgttctccaaggaagagaagctgactgacaacaataaggtg
ttctgcagacactgcaaagcccacagagactccaccaagaaactggagatctggaaggtc
ccacccattctgctggtgcacttaaaacggttttcctatgagggcagatggaaacagaag
ctgcaaacgtctgtggatttcccattagacagtctggacctggcccagtatgtcattgga
cccaaacagagcctgaaaagatacagcctttatgcggtttcaaaccactatgggggtttg
gatggtggccattacacagcctactgtaagagtgcccttaaacagcgctggtacaagttt
gatgaccacgaggtgtctgacatctccacctcctcggtcaagtcctccgcagcctacatt
ctgttttactccaccctgtga

DBGET integrated database retrieval system