KEGG   Takifugu rubripes (torafugu): 101064629Help
Entry
101064629         CDS       T02386                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101064629
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101064629
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101064629
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101064629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 522 aa AA seqDB search
MGLSLPSLVLLLVCYLNVEETFGSGSSKCIARNFGQDSVVCECNSTYCDSVGSVTLPPVG
HFSSYLSSMSGSRLEAGQGQVQANSTAEGLRLTVVPHQKYQKIKGFGGAMTDAAAINILS
LSSAAQDQLLRQYFSAEGIGYTVVRVPMASCDFSTRLYTYADTPGDYNLDRFKLAPEDVN
MKIPLLQRAQALSPLPLSLMASAWSAPAWMKTNGALVGKGSLKGQPGGREHKTWAHYYIR
FLEEYAKYNLTFWALTTGNEPSAGMMTNYSFQALGFTPREQRDWVSLDLGPAVHASAFPH
THVLILDDNRLLLPYWAKIVLSDVHAGRYVHGVAVHWYMDSLVPAEMTLGVTHHLYPEYY
LFGTEACAGWNPLDRGVKLGSWQRAEQYAHDIIEDLNHYVVGWTDWNLALDHIGGPNWVK
NYVDSTVIVDAQRDVFYKQPTFYSMAHFSKFLWEGSQRVGVSSNQETDLGYSAFIRPDGS
VVLIVLNRSPSAVRFEVWDPSVGYVPATAPAHSLLTLAWKTV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggggttgtcgctgccatcactggtgcttctgttggtctgttacctcaatgtggaagag
acttttggctcaggaagttccaaatgtatcgccaggaactttggccaggactcggtggtg
tgcgagtgtaattcgacctactgtgacagtgttggcagcgtcaccttgcctcctgtgggt
catttctcctcctacctaagcagcatgtctggcagcaggctggaggccggtcagggtcag
gtccaggcgaacagcaccgccgaaggcctcaggctaaccgtcgtcccacaccagaagtac
cagaagattaaagggtttggtggcgctatgacagatgcagcagctattaacatcctgtcg
ctctcttccgcggctcaagaccagctgctgcggcagtacttttccgctgaaggtattggc
tacactgtggtgcgtgtgcccatggccagctgtgacttctccacccgtttgtacacgtat
gctgatactcctggcgactacaacctggatcgttttaaactggcccccgaggacgtcaac
atgaagatcccgctcctgcagcgcgcccaggctctatctcctcttcctctctctttgatg
gccagtgcctggagcgcccctgcctggatgaaaactaatggcgcacttgtagggaagggt
tcgctcaagggccaaccagggggcagggagcacaaaacctgggctcactattatatcagg
ttccttgaagaatacgcaaaatacaatttgaccttttgggcgctgaccacggggaacgag
ccgtctgcaggaatgatgacgaactacagcttccaggctctgggtttcactccccgtgag
caacgggactgggtgtctctggacctgggccctgctgtgcatgcttctgcattcccccac
acgcacgtactcatactggatgacaaccgcctgctgttgccttactgggctaaaatagtc
ctgagcgatgtccacgcggggcgttacgtccacggcgtggcagttcactggtacatggac
agcttggtcccggctgaaatgaccctgggggtcacccaccacctctacccggaatattac
ctgtttggcacggaggcgtgcgctggctggaacccgctggacagaggggtgaagctgggc
agctggcagagggccgaacagtacgcacatgatatcatagaggacttgaatcattatgtg
gtgggctggacggactggaacctggcgttggaccacatcggtggaccaaactgggtcaaa
aactacgtggacagcactgtcatcgtggacgcacagcgggacgtcttctacaagcagccg
acgttctacagcatggcccacttcagcaagttcctgtgggaggggtcccagagagtgggc
gtgtcctccaatcaggaaacagacctgggctactccgccttcatcaggcccgatggctca
gtcgttctcatcgtactcaacaggtcgccgtctgcggtccggtttgaggtgtgggacccc
tccgtgggctacgtgcccgccaccgctccggctcattctctgctcacactggcttggaaa
acagtctga

DBGET integrated database retrieval system