KEGG   Takifugu rubripes (torafugu): 101064671Help
Entry
101064671         CDS       T02386                                 

Definition
pancreatic alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101064671
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101064671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 381 aa AA seqDB search
MKVFILVALFGLSFAQHNPYFKDGRTSFVHLFEWRWADIAEECERFLGPNGFGGVQISPP
SENIVLDSPWRPWWQRYQPIGYNLCSRSGSENELRDMITRCNNVGVNIYIDAVINHMCRE
NNGAETHSSCGSWFNAGMKDFPSVPYSYLDFNGYKCKKSSGNIENYHDVYQVRDCRLDGL
LDLALEKDYVRAKVADYMNKLINMGAAGFRVDACKHMWPGDLSAVYGGLHKLNTKWFPNG
XXGAKLGTVFRKWNNEKLMYTKNWGEGWGFMPYGNALVFVDNHDNQRGHGAGGASIVTFW
DARLHKMAVGYMLAHPYGVTRVMSSFRWNRHIVNGKDKNDWMGPPSHPDGSTKSVPINPD
ETCGDGWVCEHRWRQIKNMVI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgtttattctggtggctttgtttgggctcagctttgcccaacacaatccctat
ttcaaggacggcaggacctcctttgttcacctgtttgagtggcggtgggcagacatcgct
gaggagtgtgagcgcttcttgggtccaaatggctttggtggagttcagatttcccctcca
agtgagaacatagttttggacagcccatggaggccctggtggcagagataccaaccaatc
ggctacaacctgtgctccagatctggaagtgagaatgagctgagagacatgatcaccaga
tgcaacaatgttggggttaacatctacatcgatgctgtcattaaccatatgtgccgtgag
aacaatggtgctgaaacacactcctcatgtggcagctggttcaatgcaggcatgaaagac
ttcccctctgtcccctattcctacttggactttaatggttataagtgtaaaaaaagcagt
ggcaacattgaaaattatcatgatgtgtatcaggtgcgcgactgtcgtctagatggcctc
ctggatctcgcccttgaaaaagattacgtgagagctaaggtggccgactacatgaacaag
cttatcaacatgggtgcggctggattcagagtggatgcctgcaagcacatgtggcccggt
gacctgtctgcagtctatggtggactgcacaaactcaacaccaagtggttccccaatggn
nnnnatggtgccaaactgggaactgtcttcagaaaatggaataatgaaaagttgatgtac
accaagaactggggagagggttggggtttcatgccttatggcaatgctcttgtcttcgtt
gacaaccatgacaaccagagaggacatggtgctggtggagcatctattgttaccttctgg
gatgccaggctccacaagatggctgtagggtacatgctggctcacccatatggagtaacc
agggtgatgtcaagcttccgttggaaccgccacattgtcaatggaaaggacaagaatgac
tggatgggtcctcccagccaccctgatggatcaaccaaatctgttcccatcaacccagat
gagacttgtggtgatggatgggtgtgtgagcacagatggcgtcagatcaagaacatggtg
att

DBGET integrated database retrieval system