KEGG   Takifugu rubripes (torafugu): 101064678Help
Entry
101064678         CDS       T02386                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101064678
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101064678
  Amino acid metabolism
   00310 Lysine degradation
    101064678
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     101064678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 462 aa AA seqDB search
MLSHSRCLTRNFSRSLSALRQGNQALARRSSTALTINHSISLNNIVKSNLPTNVFQIQYF
RTSVAYRDEVVTVKTPAFAESVTEGDVRWEKAVGDTVTEDEVVCEIETDKTSVQVPSPAA
GVIEELLVPDGGKVEGGTPLFKLRKGAGAPKAAEAPKAEAPAAAAPPPPSAAASPPPPAS
TVGPIPTSMPPVPPVPAHAMDTKPVSAIKPSVAAASPAAQAEGAAKGVRTESRVKMNRMR
LRIAQRLKEAQDTCAMLTTFNEVDMSNISEMRKTYKDAFLKKHNIKLGFMSAFVKAAAYA
LTDQPAVNGVIDDTTKEIVYRDYVDISVAVATPKGLVVPVIRNVEGMNFADIEKTINMLG
EKARKNELAVEDMDGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGIFDRPVAIGGKVE
IRPMMYVALTYDHRLIDGREAVTFLRKIKSVVEDPRVLLLDM
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgttatcccattcccggtgtctcaccaggaatttcagccgttctctgtctgccctccgc
caggggaatcaggcgttggctcgtcgctcatccactgctctaacaattaaccactctatc
tctctcaacaacattgtaaagtcaaacctccccactaatgtcttccaaatccagtacttc
aggacatctgttgcctacagggatgaagttgtcacagttaagacccctgcctttgcagag
tctgtcacagagggggacgtaaggtgggagaaagctgttggagacaccgtcactgaggat
gaggtggtgtgtgaaattgagactgataagacatcagtgcaggttccgtctcctgctgct
ggagtgattgaagagcttttggtccctgatggagggaaggttgaagggggaacgccactc
ttcaagcttcgaaaaggagcgggtgctcctaaagctgccgaagctccaaaagctgaagcc
cctgctgctgcagccccaccaccaccttctgctgctgcttctccacctcctcctgcctcc
accgtgggacccattcccaccagtatgccccctgtgccacctgtgccagcacatgctatg
gacaccaaaccggtatcagccatcaagcccagcgttgccgccgcttcacctgcggcacaa
gcagagggtgcagctaaaggagtcaggacagagagcagggttaagatgaaccgcatgagg
ctgagaattgcccagaggctgaaggaagcccaggacacctgtgctatgttgactacattt
aatgaggtcgacatgagcaacatctccgagatgaggaagacgtacaaagatgccttcctg
aaaaaacacaacatcaagttgggcttcatgtctgcgtttgtgaaggctgctgcctacgct
ctgactgaccagcctgccgtcaacggggtaatcgatgacacgacaaaggaaattgtgtac
agggattacgtggacatcagtgttgccgtggctacaccaaagggtctggtggttcctgta
atccgaaacgtggaagggatgaactttgctgatattgagaagaccatcaatatgctgggt
gaaaaggcccgtaagaacgagctggccgtcgaggacatggacggaggaaccttcaccatt
agcaacggcggcgtgtttggctccatgttcggtacccctataatcaacccgcctcagtcc
gccatcttaggcatgcacggcatcttcgaccggcctgtcgccatcggtggaaaggtggag
atccgtcccatgatgtacgtcgccctgacgtacgaccaccgtctgattgacggcagagaa
gcggtcaccttccttcgcaagatcaagtctgtggtggaggaccccagggtgctgctcctc
gacatgtga

DBGET integrated database retrieval system