KEGG   Takifugu rubripes (torafugu): 101064678Help
Entry
101064678         CDS       T02386                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tru01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tru00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tru00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 462 aa AA seqDB search
MLSHSRCLTRNFSRSLSALRQGNQALARRSSTALTINHSISLNNIVKSNLPTNVFQIQYF
RTSVAYRDEVVTVKTPAFAESVTEGDVRWEKAVGDTVTEDEVVCEIETDKTSVQVPSPAA
GVIEELLVPDGGKVEGGTPLFKLRKGAGAPKAAEAPKAEAPAAAAPPPPSAAASPPPPAS
TVGPIPTSMPPVPPVPAHAMDTKPVSAIKPSVAAASPAAQAEGAAKGVRTESRVKMNRMR
LRIAQRLKEAQDTCAMLTTFNEVDMSNISEMRKTYKDAFLKKHNIKLGFMSAFVKAAAYA
LTDQPAVNGVIDDTTKEIVYRDYVDISVAVATPKGLVVPVIRNVEGMNFADIEKTINMLG
EKARKNELAVEDMDGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGIFDRPVAIGGKVE
IRPMMYVALTYDHRLIDGREAVTFLRKIKSVVEDPRVLLLDM
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgttatcccattcccggtgtctcaccaggaatttcagccgttctctgtctgccctccgc
caggggaatcaggcgttggctcgtcgctcatccactgctctaacaattaaccactctatc
tctctcaacaacattgtaaagtcaaacctccccactaatgtcttccaaatccagtacttc
aggacatctgttgcctacagggatgaagttgtcacagttaagacccctgcctttgcagag
tctgtcacagagggggacgtaaggtgggagaaagctgttggagacaccgtcactgaggat
gaggtggtgtgtgaaattgagactgataagacatcagtgcaggttccgtctcctgctgct
ggagtgattgaagagcttttggtccctgatggagggaaggttgaagggggaacgccactc
ttcaagcttcgaaaaggagcgggtgctcctaaagctgccgaagctccaaaagctgaagcc
cctgctgctgcagccccaccaccaccttctgctgctgcttctccacctcctcctgcctcc
accgtgggacccattcccaccagtatgccccctgtgccacctgtgccagcacatgctatg
gacaccaaaccggtatcagccatcaagcccagcgttgccgccgcttcacctgcggcacaa
gcagagggtgcagctaaaggagtcaggacagagagcagggttaagatgaaccgcatgagg
ctgagaattgcccagaggctgaaggaagcccaggacacctgtgctatgttgactacattt
aatgaggtcgacatgagcaacatctccgagatgaggaagacgtacaaagatgccttcctg
aaaaaacacaacatcaagttgggcttcatgtctgcgtttgtgaaggctgctgcctacgct
ctgactgaccagcctgccgtcaacggggtaatcgatgacacgacaaaggaaattgtgtac
agggattacgtggacatcagtgttgccgtggctacaccaaagggtctggtggttcctgta
atccgaaacgtggaagggatgaactttgctgatattgagaagaccatcaatatgctgggt
gaaaaggcccgtaagaacgagctggccgtcgaggacatggacggaggaaccttcaccatt
agcaacggcggcgtgtttggctccatgttcggtacccctataatcaacccgcctcagtcc
gccatcttaggcatgcacggcatcttcgaccggcctgtcgccatcggtggaaaggtggag
atccgtcccatgatgtacgtcgccctgacgtacgaccaccgtctgattgacggcagagaa
gcggtcaccttccttcgcaagatcaagtctgtggtggaggaccccagggtgctgctcctc
gacatgtga

DBGET integrated database retrieval system