KEGG   Takifugu rubripes (torafugu): 101064772Help
Entry
101064772         CDS       T02386                                 

Definition
tyrosinase-like
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101064772
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    101064772
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101064772
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     101064772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 540 aa AA seqDB search
MRITCASMLLLQLITASLSQFPRPCANSEGLRTKECCPVWDGDSSACGALSGRGFCTDVE
VSDEPHGPQYPHTGIDDRERWPLAFFNRTCHCTGNYGGFDCGECKFGYWGSNCAEYRELV
RRNILTLSTAEQQKFISYLNLAKSTISAAYVISTATRAEMGENGERPMFSDINTYDLFVW
MHYYVSRDAFLGGPGNVWTDIDFAHESAAFLPWHRVYLLHWENEIRKLTRDSNFTIPYWD
WRDAQTCDVCTDALMGGRSPFNPNLISPASVFSAWRVICTQPEDYNNREVLCNTTGEGPL
LRNPGNHDPNRVRRLPTTADVESVINLPEYETDSMDRFANRSFRNAVEGFADPETGMSVL
GQSTMHNALHVFMNGSMSSVQGSANDPIFLLHHAFIDSIYERWLRTHQPPRSSYPRANAP
IGHNDRYYMVPFMPLYRNGDYFLSDKALGYEYAYLLDPGQRFVQEFLTPYLQQAQDIWPW
LLGAGILGGLVATVIGVLTVLWRRKLKQNQRKRRASSYGERQPLLQSSSEEGSSSYQTTL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcacctgtgcatcgatgctcctgctgcagcttatcacggcatctttatcccag
tttcctcgtccatgtgccaactcagagggactgaggaccaaagagtgttgtcctgtgtgg
gatggtgacagctcagcctgtggtgccttgtcaggtcgtgggttttgcactgatgttgag
gtttcagatgagccccacgggccccagtatccacacactgggatagatgacagggaacgc
tggcccctagctttctttaaccggacgtgccattgtactggaaactatggaggctttgac
tgtggtgaatgtaagtttggttactggggttcaaactgtgctgaatacagggagttggtg
aggaggaacatcctcactctgtcaacagccgagcagcagaaattcatctcttacctcaac
ctggccaagagcaccataagtgctgcctatgtgatctctacagccacaagagcagagatg
ggggagaacggggagaggcccatgttctcggacatcaacacctacgacctgtttgtttgg
atgcattactacgtgtctcgggatgcattcctgggaggtccggggaacgtatggacagac
attgactttgctcacgaatctgcagcctttctgccatggcatcgcgtttacctcctccac
tgggagaatgagatcaggaagctgaccagagattccaacttcaccatcccatattgggac
tggagggatgcccagacctgtgatgtgtgcacggatgctttgatgggaggacgcagcccc
tttaatccaaaccttatcagccctgcctctgtcttctctgcgtggagggtgatctgcacc
cagccggaagactacaacaatagagaggtcctgtgtaacaccactggggagggtccactt
ttgcgtaaccctggcaatcatgacccaaaccgcgtgcgtcgactccctacaacagcagat
gtcgaatctgtcataaacctccctgaatatgaaactgattctatggatcgttttgcaaac
aggagctttagaaatgcagtagaaggttttgcagatccagagaccggcatgtccgtgctg
ggccagagcaccatgcacaatgctctgcatgtcttcatgaacggctccatgtcatcagtg
cagggctcagccaatgacccgatattccttcttcaccatgctttcattgacagcatctat
gagcgctggctcaggactcaccagcctcccaggagcagctacccacgtgccaatgccccc
atcggccacaacgacagatactacatggtgccattcatgcctctctacagaaatggcgac
tacttcctgtccgacaaggctcttggttatgaatatgcctacttgttggatcctggccaa
aggtttgttcaggagttcctgaccccctatcttcagcaggcacaggacatttggccatgg
ctcctcggggctgggatccttggcggcctggttgccaccgttattggcgttcttactgtt
ttgtggagaagaaagttgaagcaaaaccagagaaagaggagagcatcgagctatggggag
agacagccactgttgcagagcagttctgaggaaggctcctcttcatatcagactactctg
taa

DBGET integrated database retrieval system