KEGG   Takifugu rubripes (torafugu): 101064906Help
Entry
101064906         CDS       T02386                                 

Gene name
echs1
Definition
(RefSeq) enoyl CoA hydratase, short chain, 1, mitochondrial
  KO
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101064906 (echs1)
   01212 Fatty acid metabolism
    101064906 (echs1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101064906 (echs1)
   00650 Butanoate metabolism
    101064906 (echs1)
  Lipid metabolism
   00062 Fatty acid elongation
    101064906 (echs1)
   00071 Fatty acid degradation
    101064906 (echs1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101064906 (echs1)
   00310 Lysine degradation
    101064906 (echs1)
   00380 Tryptophan metabolism
    101064906 (echs1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101064906 (echs1)
Enzymes [BR:tru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     101064906 (echs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 324 aa AA seqDB search
MQEVTYPGKGGVCLELTATLLADSLAASLLLVVMSFLWTSSALLLKSSRAAPALLSAARL
YSSGGQYEYILVEKRGEENNVGFIQLNRPKALNALCDGLMREVGQALDNFEADGGVGAIV
ITGSERAFAAGADIKEMQNQTFQRCFAGNFLAHWNRVSTMKKPVIAAVNGFALGGGCELA
MMCDIIFAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMKMVLTGDRINAQEAKQS
GLVSDVYPVDQLVSEAVKCGEKIASNSKLVTAMAKEAVNSAFELSLAEGNRLEKRLFHAT
FATEDRKEGMTAFVEKRKANFQDN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaagtgacgtatccaggaaaaggcggagtctgcctcgaactgacagcaaccttg
ctagcagattcattagcagcgtccctccttcttgtcgtcatgtctttcctttggacaagt
tctgctttgcttctgaagtcgtccagagcagcaccggctctgctttctgctgctcgcctc
tacagctcaggtggccagtatgagtacattttagtggaaaagcgaggtgaggagaacaac
gtgggtttcatccagctgaaccgacccaaggctctgaacgccctgtgtgatggcctgatg
cgggaggtgggacaggccttggacaactttgaggccgacggtggtgttggagccatcgtc
atcactggcagtgagagagcctttgctgctggagcagatattaaagagatgcagaatcaa
accttccagcggtgttttgctggaaacttcttggctcactggaacagagtgtccaccatg
aagaagcctgtgattgctgctgtcaatggttttgctctgggtggaggctgtgagctggcg
atgatgtgtgatatcatctttgctggggagaaggcacagtttggccagccagagatcctg
ctgggtacaattccaggtgcgggtggcacccagaggctgacccgcgctgtgggcaaatcc
ctggccatgaaaatggttctaacaggcgacagaattaatgcacaagaagccaaacaatca
ggtttggtcagtgatgtttatcctgtcgatcagctggtgtctgaagctgtaaaatgtggt
gaaaaaatagcttccaactccaaacttgtcaccgctatggccaaagaggctgtaaattca
gctttcgaactgagtctggccgagggcaaccgtttggagaagcgcttattccacgctacc
ttcgctacggaagaccgtaaggaaggcatgacggcattcgttgagaagagaaaagccaat
tttcaggacaattaa

DBGET integrated database retrieval system