KEGG   Takifugu rubripes (torafugu): 101064975Help
Entry
101064975         CDS       T02386                                 

Gene name
usp36
Definition
(RefSeq) ubiquitin specific peptidase 36
  KO
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101064975 (usp36)
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101064975 (usp36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 1120 aa AA seqDB search
MPIVDKLKEALKPGRKETSDEGDLNKLLASSAKKVLLQKIEFEPASKGFSYQLDSLKNKY
VILNPRNEGATCQKPAEPVQIKRQVSENVVGGQSDGIPAPQKMLFPGNKLTLKWERVYRV
GAGLHNLGNTCFLNSTVQCLTYTPPLANYLLSKEHSRTCHQSGFCMICVMQNHIIQAFAN
TGNAIKPVSFIRDLKKIARHFRFGSQEDAHEFLRYTIDAMQKACLSGYPKLDRQTQATTL
VHQIFGGYLRSRVKCSICKSVSDTYDPYLDIAVEIRQAANIVRALELFVKPDVLSGENAY
MCAKCKKKVPATKRFTVHRTSNVLTVSLKRFANFSGGKITKDVGYPEFLNIRPYMSQSSG
DPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNIKVVLNQQAYVLFY
LRIPETKKNADGLTTKQGVLHPGKNSLSSDQIKRTNLSGPLSSPQVTKKLEPAQLRKIQS
MDGGLGLPVSRNGLSSQQQPRLSNWTSSSSSSPKPPSGPTVIEEPFKKLKKPSPQSQAQS
RSTTPTPSNNGIGKTEGDKKQGGEGRGMVASTSNKSLSDSSCADTTESKDSIGTKSAPVG
QTPSTPRKGANGLPSPAKSLERSQSAEEQKPKIKPPALNNITAEATSTMSPPPAKKLALS
AKKARSRSPSSIDAPPPFPRQPSRDPTHQTHLDLLTFVSPTRPHRADPLPSPKVQASNGS
FRQPSLHKQPLLSTQQKPNACISPLTNGHTAKLKSPKSSGNLGSWKEEPDLSSTAALQFN
QSKKRRRKKKRQHSEEQDGAEPLVPAATEPQVDSGNDQRKKKRKKKRKRENEENAMERGC
VPSHLDALSQEEDWCHGGIWSLTVRSDTEQPGPKSQLAARTEPQSDSEKVKKRKKKKKKM
EALLDTSALSASETVPETKAPVDQSDAAVLKKKLKKKKRRLKEEESRRGSDGHNGDADTE
EPSTKKNATANGKESKHGKATVVMWDSQVKDGYKRGQTGESKAGETLPRAAPVTWDGQKT
SVVVEELLRNSSDKAYGANILSWDGEVSAVSKDAIEDAINAKSDTVIDEWDEEFDRGKVK
KIKSYKKERWRGSNIFQKVQDRRNKWSVMPGGKRVFGIRR
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atgccgatagtcgataaactcaaggaggccttaaaacccggtcgaaaggaaaccagcgat
gagggtgacctcaacaaactgctggcttcctctgccaagaaggtccttttgcagaagata
gagtttgagccagccagcaagggtttctcctaccagctggacagcctgaagaacaagtat
gtgattctcaatcccaggaatgaaggtgcgacctgccagaagcctgctgagcctgtccag
ataaagaggcaagtctcagaaaatgtggttgggggtcagagtgatggcatccctgcccct
cagaagatgctgtttccagggaacaaacttaccctgaaatgggagcgtgtgtacagggtg
ggagccggcctccataacctcgggaacacgtgcttcctcaactctacagtacagtgtctc
acctacacccctccgctggccaactaccttctgtcaaaggagcacagtcggacctgtcac
cagtctggcttctgtatgatttgcgtgatgcagaaccacatcattcaagccttcgccaac
acaggaaacgccatcaagcccgtgtctttcatccgagatctgaaaaaaattgcgagacat
tttcgctttgggagccaagaggacgcccacgagtttttgcggtacaccatcgacgccatg
cagaaggcgtgcctcagtggctaccccaagctcgacaggcagactcaagccacgaccctg
gttcaccagatcttcggagggtacctcaggtccagagtgaagtgctccatttgcaaaagc
gtgtcagacacctacgacccgtacctggacatcgctgtggagattcggcaagcagcaaac
attgtgcgagccttggaactgtttgtgaaaccggacgtgctgagtggagagaacgcctac
atgtgtgccaagtgcaaaaagaaagtgccggcaaccaaacgtttcacagtccaccggacc
tctaatgtcctgacggtctcgctgaagaggttcgctaacttcagcggaggcaaaataaca
aaggatgtgggctacccagaattcctgaatatccgaccctacatgtctcaaagctcaggc
gaccctgtaatgtatggcctctatgctgttctggtgcactcaggctacagctgccacgcc
ggccactattactgctatgtcaaggcaagtaacggacaatggtaccaaatgaacgattct
ctggtacactccagtaacatcaaagtggtgctgaaccagcaggcttatgtacttttctac
ctgaggatccctgaaaccaaaaagaatgctgacggtctgaccaccaagcagggggtgttg
catcctgggaagaacagcctgtcgtccgaccagataaagagaaccaacctgagcgggcct
ctctcttcaccgcaagttacaaagaaacttgagcccgcacagctgcgtaagatccagtcc
atggatggaggtctgggtctgcctgtttccagaaatggtctgagctctcagcagcagccc
agactttccaactggacgtcgtcctccagcagctccccgaagcccccaagtggacccacg
gttatcgaggaacccttcaaaaaactgaagaagccctctccccagagccaggcgcagtcc
cgcagcaccactccgaccccctccaacaacggcatcggcaagacggaaggagataaaaag
caaggtggcgagggcaggggcatggtggcatctacctcaaacaagtccttgtccgactct
tcctgtgcggacaccacagaatcaaaggactccatcggcaccaaaagcgccccggtggga
cagactccctccacgccgcgcaaaggcgccaacggcctgccatccccagccaagagcttg
gagcgttctcagagcgccgaggaacagaagccgaagatcaagcccccggccctcaacaac
atcacggctgaagccacgagcactatgtcccctccccccgccaagaaactggccctgtct
gctaagaaggctcgcagtcggagtccgagcagcattgatgctccgcccccttttccgcgc
cagccgtcccgtgacccaacacatcaaactcaccttgaccttctcacctttgtctccccc
actcgccctcacagagctgatccattaccttcacctaaagttcaggcatcaaacggatcc
ttcagacagccgagtcttcacaaacagccccttctgtccactcagcaaaaaccaaacgca
tgcatttcccctttaaccaatgggcacaccgccaaactaaagagccccaagtcttccggc
aacctcggctcctggaaggaagagcccgacctcagcagcacagcagctctgcagtttaac
caaagcaagaagaggaggaggaagaagaagagacagcactccgaggagcaggatggcgcg
gagcctctcgttccagctgcaacggagccgcaggtggattctggtaacgatcaaaggaag
aagaagaggaagaagaaacgaaagagggaaaacgaggagaacgcgatggagaggggatgc
gtcccgtctcacctggatgcgttgagccaagaggaagattggtgtcacggtggcatctgg
agtctgaccgtgcgttcagacacggaacagcccggaccaaagtctcagttggctgccagg
acggagccgcagagcgattctgaaaaggtaaagaagagaaagaagaagaaaaagaagatg
gaggcactgctggacacttcagcgctttctgcttcagaaacggttcctgagacgaaggct
cctgtcgatcagagtgacgcggcagttttgaaaaagaagttgaaaaagaagaagaggcgg
ctaaaagaggaggagagccggcgaggctccgatgggcacaacggtgatgctgatacagaa
gaaccctctaccaaaaaaaatgccaccgccaacggaaaagaaagtaaacatggcaaagcc
acggtggtcatgtgggacagccaagtgaaagacggctacaaacgcggccagactggagag
agcaaagcaggagagaccctccctcgtgctgctcccgtgacctgggatgggcaaaagacc
agcgtcgtcgtggaagagctgctcaggaactcctcggataaggcctacggagccaacatc
ctcagttgggatggggaggtctctgctgttagcaaagatgccatcgaagatgccattaac
gccaagagtgacactgtgatcgatgagtgggatgaagagttcgacagaggaaaggtgaag
aagataaaaagctacaaaaaagaaaggtggagaggcagcaacatcttccagaaggtccag
gacaggaggaacaagtggtccgtaatgccgggagggaaacgggtgtttggaatacggcgc
tga

DBGET integrated database retrieval system