KEGG   Takifugu rubripes (torafugu): 101064978Help
Entry
101064978         CDS       T02386                                 

Definition
TGF-beta receptor type-2-like
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tru04010]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:tru04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tru04068]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:tru04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:tru04144]
Cellular Processes; Cell communication; Adherens junction [PATH:tru04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 605 aa AA seqDB search
MQELEGRSEQAVERDKSEKQQQLKSKEDDVDKTPPPFIPAQAAPNLLRHVRPCMPSFFPM
NQLCKFCDVESSNCSGTGTCTSNCSITAICSSAEEICVALWRKNETGFSIETLCHDPSKS
LYGMMLDDFNSSACLMKEKNTTGGMVQVCSCTGDECNNFLIFSPVVDPSPDDPLVSVVLV
SLLPLLVMGIAGMFYWYRVHRPRLRSQEWKSSIKKRKPKSGGLDCSDVCVIMMDDDRSDS
SSTDANNLNHNTEPLPIELDQLVGKGRFAQVYKAKLKQAASDQFETVAVKIFPYEEYASW
KNEKDIFSNSDLRHENVLHFLTAEEKKAQRQYWLITAFHTRGNLQEHLTHNIISWEELKI
LGSSLARGVSHLHSDRLPCGRPKVAIVHRDLKSSNILVKNDLTCCLCDFGLGLQLDSSLS
VDDLANSGQVGTARYMAPEVLEARLNLENIESFKQADIYSMALVLWEMTSRCEAVGEVKD
YEPAYGSKVREHPCVESMKDNVLRDRGRPEIPDTWLRHQGVAMMCGTIMECWDHDPEARL
TAHCVAERISEMEDEMDKLSSHSSSTEKIPEELKIPTEVEIPEEMMKITELQDIIAVDCS
VSDQK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaactggagggcaggtctgaacaggctgtggagcgagataaatcagagaagcag
cagcagctcaaatctaaggaggacgatgtggataagacccccccccccttcatcccggcc
caggcagcccccaacctgctgcgccatgtcaggccatgtatgcccagcttcttcccgatg
aaccagctctgtaagttctgcgatgttgaatcctctaactgcagcgggacggggacgtgc
acatccaactgctccatcacagccatctgctcctccgctgaagaaatctgcgtggccctc
tggaggaagaacgagacaggattctccatcgagactctgtgtcacgacccttcaaagtca
ctttacggcatgatgctggatgatttcaacagctccgcctgcttgatgaaggagaagaac
acgaccggtggaatggttcaggtctgctcctgcacgggggatgagtgtaacaactttctg
atcttctctcccgtggtggatccgagtcccgacgaccccctggtgtccgtggtgctggtg
agcctcctccctctgctggtgatgggcatcgcaggaatgttctactggtaccgagtgcac
cggccacgcctgcgcagccaagagtggaagagcagcatcaagaaacgcaaaccgaaaagc
ggaggcctggactgcagtgacgtctgcgtcatcatgatggacgacgacagatctgacagc
agctccacggacgccaacaacctgaaccacaacacggaaccgctgccaatagaactcgat
cagctggtggggaagggtcgcttcgcccaggtctacaaggctaagttgaagcaggccgcc
tccgatcagtttgaaacggtggccgtgaagatcttcccgtacgaggaatacgcttcctgg
aagaatgagaaggacatcttctccaattcagacctgcggcacgagaacgtcctccacttc
cttacagccgaggagaaaaaggctcagaggcagtactggctcatcactgccttccacacc
agaggaaacctgcaggaacacctgacgcataacatcatcagctgggaggagcttaagatt
ctggggagctcgttagctcggggcgtctctcacctccacagtgaccgcctcccctgcgga
cgcccaaaggttgccatcgtccaccgtgacctcaagagctccaacatcctggtgaagaac
gacctgacctgctgcctgtgcgacttcgggctgggcttgcagctggacagcagcctgtct
gtggatgatctggccaatagtggacaggtgggtacggcccgttacatggctcctgaggta
ctggaggcccggctgaacctggaaaacattgagtccttcaagcaggccgatatctactcc
atggcgctggtgctttgggagatgacgtcgaggtgcgaagctgttggagaggtgaaggac
tatgagcctgcctatggctccaaagtgcgagagcacccctgtgtggagagcatgaaggac
aacgtgctgagagacagaggaaggcctgagatccccgacacctggctcagacaccagggc
gtggccatgatgtgcggcaccatcatggaatgctgggaccacgaccccgaggcccggctc
acggcccactgcgtcgccgagcgcatctccgagatggaggacgagatggacaaactgtcc
agccacagctcgtccacagagaagatccccgaggagctgaagatcccgacagaggtggag
atccctgaggagatgatgaaaatcacagagctacaggacatcatcgccgtcgactgttcg
gtcagcgaccagaagtga

DBGET integrated database retrieval system