KEGG   Takifugu rubripes (torafugu): 101064978Help
Entry
101064978         CDS       T02386                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
Module
TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101064978
   04350 TGF-beta signaling pathway
    101064978
   04068 FoxO signaling pathway
    101064978
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101064978
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101064978
  Cellular commiunity
   04520 Adherens junction
    101064978
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101064978
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   101064978
Enzyme-linked receptors [BR:tru01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   101064978
Cytokine receptors [BR:tru04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   101064978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 577 aa AA seqDB search
MEDQRCSLSLSIFFLTVLLDSGTTGMPSFFPMNQLCKFCDVESSNCSGTGTCTSNCSITA
ICSSAEEICVALWRKNETGFSIETLCHDPSKSLYGMMLDDFNSSACLMKEKNTTGGMVQV
CSCTGDECNNFLIFSPVVDPSPDDPLVSVVLVSLLPLLVMGIAGMFYWYRVHRPRLRSQE
WKSSIKKRKPKSGGLDCSDVCVIMMDDDRSDSSSTDANNLNHNTEPLPIELDQLVGKGRF
AQVYKAKLKQAASDQFETVAVKIFPYEEYASWKNEKDIFSNSDLRHENVLHFLTAEEKKA
QRQYWLITAFHTRGNLQEHLTHNIISWEELKILGSSLARGVSHLHSDRLPCGRPKVAIVH
RDLKSSNILVKNDLTCCLCDFGLGLQLDSSLSVDDLANSGQVGTARYMAPEVLEARLNLE
NIESFKQADIYSMALVLWEMTSRCEAVGEVKDYEPAYGSKVREHPCVESMKDNVLRDRGR
PEIPDTWLRHQGVAMMCGTIMECWDHDPEARLTAHCVAERISEMEDEMDKLSSHSSSTEK
IPEELKIPTEVEIPEEMMKITELQDIIAVDCSVSDQK
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggaggatcagcgctgctctttatctctgtccattttcttcttgacggtgctgctggac
tccggtaccaccggtatgcccagcttcttcccgatgaaccagctctgtaagttctgcgat
gttgaatcctctaactgcagcgggacggggacgtgcacatccaactgctccatcacagcc
atctgctcctccgctgaagaaatctgcgtggccctctggaggaagaacgagacaggattc
tccatcgagactctgtgtcacgacccttcaaagtcactttacggcatgatgctggatgat
ttcaacagctccgcctgcttgatgaaggagaagaacacgaccggtggaatggttcaggtc
tgctcctgcacgggggatgagtgtaacaactttctgatcttctctcccgtggtggatccg
agtcccgacgaccccctggtgtccgtggtgctggtgagcctcctccctctgctggtgatg
ggcatcgcaggaatgttctactggtaccgagtgcaccggccacgcctgcgcagccaagag
tggaagagcagcatcaagaaacgcaaaccgaaaagcggaggcctggactgcagtgacgtc
tgcgtcatcatgatggacgacgacagatctgacagcagctccacggacgccaacaacctg
aaccacaacacggaaccgctgccaatagaactcgatcagctggtggggaagggtcgcttc
gcccaggtctacaaggctaagttgaagcaggccgcctccgatcagtttgaaacggtggcc
gtgaagatcttcccgtacgaggaatacgcttcctggaagaatgagaaggacatcttctcc
aattcagacctgcggcacgagaacgtcctccacttccttacagccgaggagaaaaaggct
cagaggcagtactggctcatcactgccttccacaccagaggaaacctgcaggaacacctg
acgcataacatcatcagctgggaggagcttaagattctggggagctcgttagctcggggc
gtctctcacctccacagtgaccgcctcccctgcggacgcccaaaggttgccatcgtccac
cgtgacctcaagagctccaacatcctggtgaagaacgacctgacctgctgcctgtgcgac
ttcgggctgggcttgcagctggacagcagcctgtctgtggatgatctggccaatagtgga
caggtgggtacggcccgttacatggctcctgaggtactggaggcccggctgaacctggaa
aacattgagtccttcaagcaggccgatatctactccatggcgctggtgctttgggagatg
acgtcgaggtgcgaagctgttggagaggtgaaggactatgagcctgcctatggctccaaa
gtgcgagagcacccctgtgtggagagcatgaaggacaacgtgctgagagacagaggaagg
cctgagatccccgacacctggctcagacaccagggcgtggccatgatgtgcggcaccatc
atggaatgctgggaccacgaccccgaggcccggctcacggcccactgcgtcgccgagcgc
atctccgagatggaggacgagatggacaaactgtccagccacagctcgtccacagagaag
atccccgaggagctgaagatcccgacagaggtggagatccctgaggagatgatgaaaatc
acagagctacaggacatcatcgccgtcgactgttcggtcagcgaccagaagtga

DBGET integrated database retrieval system