KEGG   Takifugu rubripes (torafugu): 101065197Help
Entry
101065197         CDS       T02386                                 

Definition
5'-AMP-activated protein kinase catalytic subunit alpha-1-like
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    101065197
   04150 mTOR signaling pathway
    101065197
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    101065197
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101065197
   04920 Adipocytokine signaling pathway
    101065197
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101065197
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   101065197
Mitochondrial biogenesis [BR:tru03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101065197
  Mitophagy factors
   Other mitophagy factors
    101065197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 572 aa AA seqDB search
MATEKNKHEGRVKIGHYILGDTLGVGTFGKVKVGQHELTKHQVAVKILNRQKIRSLDVVG
KIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLDEKESRRL
FQQIISAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNY
AAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFFTPQYLNP
SVISLLKHMLQVDPMKRATIREIREDEWFKQDLPKYLFPEDPSYSNNMIDDEALKEVCEK
FECTEEEVLACIYSRNHQDPLAVAYHLIIDNRRIMNEAKDFYLASSPPDSFLDDQHMTTS
GVVTGVVKPHPERVPFLVAETLPRPRHKLDELNPQKSKHQGVRRAKWHLGIRSQSRPNDI
MSEVCRAMKQLDYEWKVVNPYYLRVRRKNPITGMQTKMSLQLYQVDSRTYLLDFRSIDDD
MLEAKSGTATPLRSGSVGNYRTAVKNDVDATDGPVTSNLVHSAKATEGSLASSLTSSTDS
TGGADNASVARPGSHTIEFFEMCANLIKLLAR
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggaaaaaaacaagcatgaaggaagagttaaaatcgggcattacattctcgga
gacacgctcggagtcgggacgttcggaaaggttaaagtgggccaacatgagctaactaag
caccaagtagcagtgaagatcttgaaccggcagaagatccgcagtttagatgtggtgggg
aagatccgcagggagatacagaacctcaagctttttcggcatcctcacataattaaactg
tatcaggtaattagcacccctactgatatcttcatggtgatggagtatgtctcaggaggc
gagctttttgattacatctgcaaaaatggaaagttggatgagaaagagagccgtcggctg
ttccagcagattatttccgctgtagactactgccacagacacatggtggtacaccgagac
ctcaagcctgaaaacgtgctgctcgatgcacatatgaacgccaaaattgcagacttcggt
ttgtcaaacatgatgtcggacggagagttcttgcgcacaagctgcggttctccaaactac
gccgcgcccgaggttatctcaggaaggttatatgctggtccagaggtggacatctggagc
agtggggtcattctttacgccctgctgtgcgggacgcttccgtttgacgacgaccacgtg
ccaaccctgttcaagaagatctgcgatgggatttttttcactccacagtatctgaaccct
tcagtgatcagcctcctcaaacacatgctgcaggtggatcccatgaagagagccaccatt
agagagatccgagaggacgagtggttcaaacaggacctccccaaatacctgttccctgaa
gacccctcttacagcaacaacatgatcgacgacgaggccctaaaggaggtgtgtgagaag
tttgagtgcacggaggaggaggtcctggcctgcatctacagtcgcaaccatcaggacccg
ctggccgtcgcataccacctcatcatcgacaatcgtcgcatcatgaacgaagccaaggac
ttctacctggcatccagccctcctgactccttcctcgacgaccagcacatgaccacatct
ggagtggtcaccggcgtcgtcaaaccccaccccgagcgcgtccccttcctggtggcagag
acgctccccaggcctcggcacaaattggacgaactgaacccccagaagtcaaagcaccag
ggtgttagaagggccaagtggcacctggggatccgcagccagagcaggcccaacgatatc
atgtcagaagtgtgtcgcgccatgaagcagttggactacgagtggaaggttgtgaatcca
tattatctgcgcgtcagaaggaagaatcccatcactggcatgcagactaagatgagcctc
cagctctaccaggtggacagtagaacttacctcctcgacttccgtagcatagacgatgac
atgttggaagcaaaatctggcactgctacgccgctgcgctctggctctgtcggcaactat
cgcaccgctgttaagaatgacgttgacgccacagacggtccggtcacgtctaacctggtg
cactcggccaaggccacagaaggctccctagcgtcatcactgacttcatccactgactca
acgggaggcgctgacaacgcatcagtggcacgacccggaagccacaccattgagttcttc
gagatgtgcgcaaatctcattaaactacttgcacgatag

DBGET integrated database retrieval system