KEGG   Takifugu rubripes (torafugu): 101065412Help
Entry
101065412         CDS       T02386                                 

Definition
OTU domain-containing protein 5-A-like
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    101065412
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101065412
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   101065412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 548 aa AA seqDB search
MTILPKKKPSSGVGVSDHADDSDRRSGSDPHQHPHTHAGRTGSRPRASPPPWSYQPNAAS
AREDRRNIEASSRPQQASSPPVGSVSPVGPGDGRDSSGGMVAGTRGDLVVSAGVVGCGGI
GSCCSGPGLSKRRRQAGTCSGAVVAALAGGGQPGVTGPGGMGSTQDTEEGAGNNSEDEYE
NAARLQTVDPATMEQQEHWFEKALCEKKGFVIKKMKEDGACLFRAVADQVYGDQDMHEVV
RKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYGT
EPINTFHGIHQNNDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPAFKPGYADQTLMKSA
IKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLQDQEKQARQPRKASATC
SSATAAASSGLEDWSARSPRQRDSDPSHSDLSNTPSSNNKPPSPAGAALILSKPPSPCAP
GPSNQSRHHLEYRAIMQEMSPTAFGLTDWEDDEILASVLAVSQQEYLDSMKHQSSSMHRE
RETSPDSS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctcccgaagaagaaacccagctccggggtaggtgtttcggaccacgccgat
gacagcgatcgcaggagcggctccgacccgcaccaacatccacacacgcacgcaggtcgg
actggatccagacccagggcttcaccgccaccctggtcctatcaacccaatgcagcctcc
gcgagggaggaccgccggaacatcgaggcgagctcacggccgcagcaggcctcctctccg
cccgtcggctctgtttcaccggtggggccgggcgacggtagggacagcagcggcgggatg
gtggcggggactcgcggcgacctcgtcgtgtcggccggcgttgtcggctgtggaggaatc
gggagctgctgttctgggcccgggctgagcaagaggcgccgacaggcaggcacttgctcc
ggtgctgtggtggcggctctggccgggggaggtcagcccggagtgacaggacctggagga
atggggtccacccaggacacagaggaaggagccggaaacaacagcgaggacgagtatgag
aacgctgcaagattacaaaccgtggacccggctacaatggagcagcaggaacactggttt
gaaaaagcgctgtgcgaaaagaaagggtttgtcatcaagaagatgaaggaggatggggcg
tgtttgttcagagcagtggcggatcaggtgtacggagaccaggacatgcacgaggtggtc
aggaagcactgtatggactacctgatgaagaatgctgattacttctccaactatgtgaca
gaggacttcaccacatacatcaacaggaaaaggaaaaacaattgccatggcaaccacatt
gagatgcaggccatggctgaaatgtacaacagaccggtggaggtgtaccagtacggcaca
gagccaataaacacctttcacggtatccaccaaaacaacgacgaacccatccgagtcagc
taccaccgcaacatccactacaactctgtagtcaacccaaacaaggccaccattggtgtt
ggcctgggactccctgccttcaaacccgggtacgcagaccagacgctgatgaaatcggcc
atcaagacgtcggaggagtcgtggatcgaacagcagatgctggaggacaagaagagggcg
acagactgggaggccacgaatgaggccatcgaggagcaggtggcccgggaatcatacctc
cagtggttacaggaccaggaaaaacaggccagacagccccggaaggccagcgccacctgt
agctcggcaacagcagctgcctccagcggtcttgaggactggagcgctcggtcgccacga
caacgagactccgacccctcccactccgacctgtcaaatactccatctagcaacaacaag
ccaccgtccccggccggagctgctctcatactgagcaaacccccctccccctgtgcacca
ggtcccagcaatcagagtcgtcatcatctggagtacagagccatcatgcaggagatgtct
cctacagcatttgggctgacggactgggaggacgatgagattctggcgtcggtgctggcc
gtgtcccagcaggagtacctggacagcatgaaacaccagagcagctcaatgcaccgggag
agggagacgtcccccgacagcagctga

DBGET integrated database retrieval system