KEGG   Takifugu rubripes (torafugu): 101065412Help
Entry
101065412         CDS       T02386                                 

Definition
OTU domain-containing protein 5-A-like
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:tru04622]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 548 aa AA seqDB search
MTILPKKKPSSGVGVSDHADDSDRRSGSDPHQHPHTHAGRTGSRPRASPPPWSYQPNAAS
AREDRRNIEASSRPQQASSPPVGSVSPVGPGDGRDSSGGMVAGTRGDLVVSAGVVGCGGI
GSCCSGPGLSKRRRQAGTCSGAVVAALAGGGQPGVTGPGGMGSTQDTEEGAGNNSEDEYE
NAARLQTVDPATMEQQEHWFEKALCEKKGFVIKKMKEDGACLFRAVADQVYGDQDMHEVV
RKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYGT
EPINTFHGIHQNNDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPAFKPGYADQTLMKSA
IKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLQDQEKQARQPRKASATC
SSATAAASSGLEDWSARSPRQRDSDPSHSDLSNTPSSNNKPPSPAGAALILSKPPSPCAP
GPSNQSRHHLEYRAIMQEMSPTAFGLTDWEDDEILASVLAVSQQEYLDSMKHQSSSMHRE
RETSPDSS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctcccgaagaagaaacccagctccggggtaggtgtttcggaccacgccgat
gacagcgatcgcaggagcggctccgacccgcaccaacatccacacacgcacgcaggtcgg
actggatccagacccagggcttcaccgccaccctggtcctatcaacccaatgcagcctcc
gcgagggaggaccgccggaacatcgaggcgagctcacggccgcagcaggcctcctctccg
cccgtcggctctgtttcaccggtggggccgggcgacggtagggacagcagcggcgggatg
gtggcggggactcgcggcgacctcgtcgtgtcggccggcgttgtcggctgtggaggaatc
gggagctgctgttctgggcccgggctgagcaagaggcgccgacaggcaggcacttgctcc
ggtgctgtggtggcggctctggccgggggaggtcagcccggagtgacaggacctggagga
atggggtccacccaggacacagaggaaggagccggaaacaacagcgaggacgagtatgag
aacgctgcaagattacaaaccgtggacccggctacaatggagcagcaggaacactggttt
gaaaaagcgctgtgcgaaaagaaagggtttgtcatcaagaagatgaaggaggatggggcg
tgtttgttcagagcagtggcggatcaggtgtacggagaccaggacatgcacgaggtggtc
aggaagcactgtatggactacctgatgaagaatgctgattacttctccaactatgtgaca
gaggacttcaccacatacatcaacaggaaaaggaaaaacaattgccatggcaaccacatt
gagatgcaggccatggctgaaatgtacaacagaccggtggaggtgtaccagtacggcaca
gagccaataaacacctttcacggtatccaccaaaacaacgacgaacccatccgagtcagc
taccaccgcaacatccactacaactctgtagtcaacccaaacaaggccaccattggtgtt
ggcctgggactccctgccttcaaacccgggtacgcagaccagacgctgatgaaatcggcc
atcaagacgtcggaggagtcgtggatcgaacagcagatgctggaggacaagaagagggcg
acagactgggaggccacgaatgaggccatcgaggagcaggtggcccgggaatcatacctc
cagtggttacaggaccaggaaaaacaggccagacagccccggaaggccagcgccacctgt
agctcggcaacagcagctgcctccagcggtcttgaggactggagcgctcggtcgccacga
caacgagactccgacccctcccactccgacctgtcaaatactccatctagcaacaacaag
ccaccgtccccggccggagctgctctcatactgagcaaacccccctccccctgtgcacca
ggtcccagcaatcagagtcgtcatcatctggagtacagagccatcatgcaggagatgtct
cctacagcatttgggctgacggactgggaggacgatgagattctggcgtcggtgctggcc
gtgtcccagcaggagtacctggacagcatgaaacaccagagcagctcaatgcaccgggag
agggagacgtcccccgacagcagctga

DBGET integrated database retrieval system