KEGG   Takifugu rubripes (torafugu): 101065526Help
Entry
101065526         CDS       T02386                                 

Definition
carboxypeptidase B-like
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     101065526
Peptidases [BR:tru01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   101065526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 416 aa AA seqDB search
MRILLVFGLVAVALAEITRFEGEKVFRLQPVLDEHVTVIKNLAQSIELDFWSPESEKQVG
IDMDVDIRVHAQYLDLVYTTLEQSGMEYEILLEDLQAAVDGQADNKPSPRAHSYTKYNTW
AQIQSWIASISTSNKDLISKEVIGNTYEGRPMTLLKLGRKSSFAKPAIFMDCGIHAREWI
SPAFCQWFVKEALSTFGSDAQMTSLLNQMDVYVLPVFNIDGYEYTHTNNRMWRKTRSRKS
GTSCVGADPNRNFDAGWCTLGASSNPCSDTFCGYSPESEIEVKNVANFIRRNKAVIKAYL
TVHSYSQLLLFPYSYSYNLAAHHSELLKVAEGASAALRSLYGTRYTSGPGATTIYPAAGG
SDDWAYDLGVKYSYTFELRDTGRYGFLLPESQIKPTCEETMLAVKYIAAYVQKNLY
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcctcctggtttttggattggtggctgttgccctggcggagatcactcgcttc
gaaggcgagaaagtcttccgtctgcagcccgtgcttgatgagcatgtgactgtcatcaaa
aacctggctcagagcatcgagcttgatttctggagccccgagagcgagaagcaggtgggc
attgacatggatgtggacatccgcgtgcatgcccagtacctggacctggtctacaccacc
ctggagcagagtggcatggaatacgagatccttcttgaggacctgcaggctgccgttgat
ggccaggctgacaacaagccctccccccgagctcacagctacacaaagtacaacacgtgg
gctcagatccagtcctggattgcctccatctccacctccaacaaagatctgatcagcaag
gaggtgatcggaaacacctacgagggtcgccccatgaccctcctcaagctcggcagaaag
tctagctttgccaagcccgccatcttcatggactgcggcatccacgccagggagtggatc
tcccctgctttctgccagtggttcgtcaaagaggctctgtctacctttggcagcgacgct
caaatgaccagcctgctcaaccagatggacgtttacgtcctgcctgtcttcaacattgat
ggctacgagtacacccacaccaacaacaggatgtggaggaaaactcgctccaggaagtca
ggaaccagctgcgttggagctgatcccaacaggaactttgatgctggctggtgcactctt
ggagcctccagcaatccctgcagcgacaccttctgcgggtacagccctgagtcagagatc
gaggtcaagaacgtcgccaacttcatccgcaggaacaaggctgtcatcaaggcctacctc
accgtccattcctactcccagctgctcctcttcccgtactcctacagctacaacctggca
gcacaccacagcgagctgttgaaggttgctgagggtgcaagtgccgctctgcgcagcctg
tacggtactcgctacaccagtggacccggtgccacaacgatctacccagctgctggtggt
tctgacgactgggcctatgacctgggagtgaagtactcctacacctttgagttgcgtgac
actggtcgttacggtttcctgctgcccgagtcccagatcaaacccacatgtgaggagacc
atgctggccgtcaagtacattgccgcctacgtgcagaagaacctctattaa

DBGET integrated database retrieval system