KEGG   Takifugu rubripes (torafugu): 101065608Help
Entry
101065608         CDS       T02386                                 

Definition
profilin-2-like
Orthology
K05759  
profilin
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:tru04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:tru05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 139 aa AA seqDB search
MSWQSYVDNLMADGSCQDAAIVGFTDAKYVWASFVGGTFANMTPEEIDVLTGKDRESFFT
SGMTLGCKKCSVIRDSLQIDGDWTMDIRTKSQGGEPTYNVSVGKAGKALVFVMGKEGVHG
GQLNKKAFQMAEYLRKSGY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaaagctacgtggacaacctgatggctgatggcagctgccaggacgcggcc
attgttgggtttacggacgccaaatacgtctgggcatcgtttgtcggcggtacctttgcc
aacatgacgcctgaagaaatcgacgtgttaacagggaaggatcgggaaagtttcttcacc
tctggaatgaccctaggctgtaaaaagtgctctgtcatcagagacagcctgcagatcgac
ggggactggacgatggacatacggacaaagagtcaaggaggcgagccgacgtacaacgtt
tctgtgggcaaagctgggaaagcattggtttttgtgatggggaaggaaggtgtccacgga
gggcagctcaacaagaaagcatttcagatggctgagtacctgaggaagtctggatattaa

DBGET integrated database retrieval system