KEGG   Takifugu rubripes (torafugu): 101065814Help
Entry
101065814         CDS       T02386                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101065814
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     101065814
Cytochrome P450 [BR:tru00199]
 Cytochrome P450, animal type
  CYP21 family
   101065814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 518 aa AA seqDB search
MSVEVLAAIGAAALLVLLLMLLRDKCVKKYHEESEYSAVKRNLPLSLWQLPLRPSSPPIP
GPPCRFLIGNMTELMHDHLPIHLTNLAKRYGNIYRLKCGNTTMIVLNSSDIIREALVKKW
SDFAGRAVSYTADIVSGGGRNISLGDYTEEWKALRRLVHGALQRCCKHSLHNVIERQALQ
LRKVLVDYRGGAVDLSEDFTVAASNVIITLVFGKEYDKSSSELQQLHRCLNEIVALWGST
WISALDTFPLLRKFPNPVFSRLLREVSRRDEIIRKHLNQFKSEGHRRTDVITGSLLEGVD
RHQTEPGVVLTDMHVHMATVDLLIGGSETTAAWLNWTVAFLLHRPEFQTKVYEELCTVLE
GRYPKYSDRQRLPILCSLIHEVLRLRPVAPLAVPHKAIRDSSIAGYFIPRNTIIIPNLFG
AHHDPEVWSDPYSFKPERFLEGGGGSTRALIPFGGGARLCLGETVAKMELFLFTAYLLRD
FCFVLPDSEAPLPDLRGVASVVLKIKSFTVIARPRTGP
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtggaagtacttgcagctatcggagctgcggccctccttgttttgctgctgatg
ttactgagggacaaatgtgttaagaaataccacgaggaaagtgagtattcagctgtgaaa
cggaacctgccgctgtccctctggcagctccctctccggccctcatctcctcccatccct
ggtcctccctgtcgctttcttatcggcaacatgacggagctgatgcacgaccacctgccg
atacacctgaccaacctggcaaagcggtacgggaacatctaccgccttaaatgtggaaac
acaaccatgattgtgctcaacagcagcgacatcataagagaggcgctggtgaagaaatgg
tccgactttgctgggagagctgtctcatacactgctgatatcgtgtccggcggcgggcgc
aacatctctctgggggactacacagaggagtggaaggcccttcgccgcctcgtccacggc
gccctgcagcgctgttgcaagcactcgttgcacaatgtgatagagagacaagcgctccaa
ctgagaaaggtgttggttgactatcggggcggcgccgtggatctgtctgaggattttact
gtggccgccagtaacgtcatcattactttggtgtttggaaaagaatacgacaaaagctcc
tcagagctgcaacagctgcaccgttgtctgaatgagattgtggctctctggggctccact
tggatctctgctcttgatacgttccctctgctcagaaaattccccaatcccgtgttttct
cgtctcctgagggaggtcagcaggagagatgaaatcatcaggaaacatctcaaccagttc
aagtcagaggggcacagaaggacagatgtgatcacaggatctctccttgaaggggttgac
aggcatcagacagaacctggagtggtcctgacagacatgcatgtccacatggcaactgta
gatcttctcatcggggggtccgagaccactgcagcctggctgaactggactgtggctttc
ctcttgcacagaccagagtttcagacaaaggtctacgaggagctgtgcacggtgctggag
ggacgttaccccaaatacagtgacagacagaggctccccatcctttgctcgctcatacat
gaagttctcaggctcaggcccgtcgccccactggcggtgccgcacaaagccatcagagac
agcagtattgcaggttacttcatccccagaaacacaatcatcatccctaatctgtttgga
gctcaccacgatcccgaagtttggtcggacccatatagcttcaaacctgagcgctttctg
gagggaggagggggctccacccgcgccctgatccccttcggaggcggagcgcgactctgt
ctgggggagactgtggctaagatggagctctttctcttcactgcatacctgctgagagat
ttttgctttgtccttcccgacagtgaagcacctctgcccgacctgaggggggtggctagc
gtcgtgcttaaaatcaagtcctttacagtcatagcacgtccccggactgggccttaa

DBGET integrated database retrieval system