KEGG   Takifugu rubripes (torafugu): 101065894Help
Entry
101065894         CDS       T02386                                 

Definition
tyrosine-protein phosphatase non-receptor type 5-like
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101065894
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101065894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 571 aa AA seqDB search
MTRRLSSTRSHTEDSIFLRPDEDPVWLDEPAKIEKLGDGVPKNDQFPKCKDGPAGGQSPQ
GEEVFMHKVYALVVQIHCWAAVFVISQVTGYWVFFVLEGNGPVSSVYKALQVIDFYLGFI
LPCHPIFGMDSVVLMKEVLNTKQHNWIIHGIAGMGVAICVVMVVHMVYKWRHNSGLCSGM
VSQDMGDRRQSVSRQPSFTLSEWTDAQEDLLDTDAAPQTPVFEMGTDTRTEGDAATLTVT
AVGLQERRGSNVSLTLDMCTPGCTEPYGYGAQLSPRDQSAQEYLRQGTHVLTPIMLHTRA
MDDQSLQSEFYETPMNFVDPKEYNYPGLVRKNRYKTILPNTHSRVILKSHDEEDFLSTYI
NANYLKGYGDEDRAYIATQGPTVNTMGDFWRMVWQERSPIIVMITNLEEKNEKCAEYWPE
DTVTHEGIEITVVTVTQEDDYSLRVFTLNCDGEERSLHHYWYTSWPDQKTPDKAPPLLEL
VQQVERARDEAPPLAGPTVVHCSAGIGRTGCFIATSILCKQLRTEGVADILRTMCQLRLD
RGGMIQTCEQYQFVHHVLSLYEKQISHTAEE
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcggctgagctccacccgttcccacactgaggactccatcttcctgcggccc
gacgaggaccccgtctggctggacgagcctgcgaagatcgaaaagctcggggacggcgtc
cctaaaaacgaccagtttccaaaatgtaaagacgggcccgcagggggccagagcccacag
ggggaagaagtgtttatgcacaaggtatacgcgctggtggtccagatccactgctgggcc
gcagtgtttgtcatctcccaagtcacgggctattgggtctttttcgtgctggaaggaaac
ggaccagtctcttccgtctacaaggccctgcaggtcattgacttctacctgggcttcatc
ttaccgtgccaccccatttttggaatggattcggtggtgctgatgaaggaagttctaaac
accaaacagcacaactggatcatccacggaatagcggggatgggtgtggccatctgcgtt
gtcatggtggtgcacatggtgtacaaatggcgccacaattctggtctgtgctcgggaatg
gtgtcgcaggacatgggcgatcggcgccagtccgtgagccgccagccctctttcaccctg
tcagagtggacagacgcgcaggaggatcttctggatacagacgctgccccccagacccct
gtgtttgaaatggggacagacaccaggacagagggcgacgccgccaccctcactgtcaca
gctgtaggccttcaggagaggaggggctccaatgtgtccctgaccttggacatgtgtact
ccgggctgcaccgagccctacggctacggagcccagttgtcccccagagaccaatcagcc
caagagtatctccgccaggggacacacgtcttgacccccatcatgctccacacgcgggcc
atggacgaccaaagcctgcagtccgagttctatgaaactcccatgaactttgttgacccg
aaggaatacaactacccaggcctggtgagaaagaaccgctataaaaccatcttacccaac
acgcacagccgagtgatcctgaagtcacatgatgaagaggatttcctgtctacatacatc
aatgctaattatcttaaaggttatggggacgaggaccgtgcctacatcgcaacccaggga
cccaccgtcaacacgatgggggacttctggaggatggtttggcaggaaaggagcccgatt
atcgtgatgatcaccaacctggaggagaaaaacgagaaatgtgcagaatactggcccgag
gacactgtgacccacgagggtatcgagatcactgtcgtcactgttacccaggaggatgac
tacagtctgagggtgtttaccttaaactgcgacggagaggagcgcagtctccatcattac
tggtacacctcgtggcctgatcagaagactccagacaaggccccgcctctcctggagctg
gtgcagcaagtggaaagggcccgggatgaggccccacccttggccggtcctacagttgtt
cactgcagtgctggtattggtcgaactggctgcttcatcgccacctccatcctttgcaag
cagctgaggactgagggcgtggcggacatcctgaggacaatgtgtcaactccgtctggac
aggggtgggatgatccagacgtgcgagcagtaccagtttgtgcatcacgttctcagcctg
tacgagaagcagatatctcacaccgccgaggagtag

DBGET integrated database retrieval system