KEGG   Takifugu rubripes (torafugu): 101065955Help
Entry
101065955         CDS       T02386                                 

Gene name
plce1
Definition
(RefSeq) phospholipase C epsilon 1
  KO
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101065955 (plce1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101065955 (plce1)
   04070 Phosphatidylinositol signaling system
    101065955 (plce1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101065955 (plce1)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101065955 (plce1)
Membrane trafficking [BR:tru04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101065955 (plce1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101065955 (plce1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1
AA seq 2024 aa AA seqDB search
MTKSVCTGTRAIVRALPSGHISEEVWKSVGTYRNWRPTKKEIGPILMCGRRKKDEFRVCR
EMQRLVWPGIMDQMVTYYVQNRKQYPLSHPCQKLLLSCPGCVCLRVSLCPETPITDRADL
SPCCRLWRCHPAHPPGVYRACLQRTSLFSLLTGALLEAIAALGARSALPYSFPQGSNSHV
VLKERQLANSMTSSSALSPAVSGISKELAEMRHLVQFPEEIACILTEQEQQLYQRVFPLD
YLCFLTRDLGSPECQSKHHPSLKASLSVPAMSTQSSRHNAVEDLVARFNEVSSWVTWLIL
TAGSMEEKREVFSYLVNVAKCCWNMGNYNGVMEFLAGLRSRKVLKMWQFMDQTDIETMRS
LKDAMAQHESSSEYKKVVTRALNIPGCKVVPFCGVFLKELSDALDGTASIISLKSPLENS
EDSIEFVSDYSGQHNFLLRSGPDGLHIPEKEATVSNILQIIRSCNRSLEVEDTDDGSTSP
SSSCPLPTSRNNSFKDRCRNQFMVGDLSDSDGDLPSEPAVKEGEFQGTEETHKAFNHGTE
LIPWYVLSLQPDVHQFLLQGATVIHYDQDSHLSARCLLRLQPDNTTLTWGNPQKGGASPT
EPPLGLGQAVVAGLAEGLLDLGVVKAVFLGHQGVDVHAVCLQNKLSHMTVEENTLSLLYG
VSTTDNRLLHFVAPNHTTQMLHKGLSELVTATRKLKKFPDQRLQWLRRQYVSLYQEDGRY
EGPTLAQAIELFGGRRWNMSTGGTEKSAHQKNSPLSINDKTKKKKKVLVRGDSGDATDDE
MVARKTRSCKEGTYRNGPESDSIDHEDPEDSFPGPFSLSTNKSPGLQASSSSSSSSSSMT
GSNQSRPQSSPTLSGTVKAQPGAWSSRSWHGRGKGCFRGFQNLMISDSTMSFVEFVELFK
SFSIRSRKDLKELFDTFAVPCIRSDPESVPLYTNLRIDDKDTGLQPDLDLLTRNGSDLGL
FIRTRQQMSDNQKQISDAIAAASIVTNGTGVENASLGVLGLGIPQLNDFLVNCQREHLSY
DEILSIIQKFEPSSSMRQMGWMSFEGFSRFLMDKDNFASHIEESQMNPEELQHPLSYYYI
QSSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFK
DVVEAISRSAFVNSNMPVVLSIENHCSLPQQRKMAEIFKTVFGERLVTRFLFESDFSDDP
HLPSPLQLQGRILLKNKKLKAHQAPVDILKQKAHQLAHMQAQVSNGSPGVSSPGTQTNED
EEEEEDEYDYDYESLSDDNLLDDKPEVKSSADKEEQPVDEIPKRMKKPDNTTQSKGKVFD
MELGEEFYLPQNKKESRQIAQELSDLVIYCQAVKFPGLSTLSPAGSGRGKDRGKSRKSIF
GTAPARCSATGEVTTPSRTPGKGGAERLSWEEQQTSPVLSPPTSLSAIIRTPKCYHISSV
NENAAKRLCRRYSQKLIQHTVCQLLRTYPAATRIDSTNPNPLLFWLHGIQLVALNYQTDD
LPMQLNTALFEANGGCGYVLKPAVLWDRNCPMYQQFCPMERDVEKMSPAVYSLAIVSGQN
VCPGNSSGSPCIEVDVLGMPVDSAHFRTKPIHRNTLNPMWNEHFQFTVHFEEMCFLRVAV
VENNSSQTTAQRTLPLKALKSGYRHIQLRTQHNESLEVSSLFIYSRRTEECPTGGDIPSS
LLFSSEEKPASQQHRVTVYGAPGPEPFTVFSVTEQITAKQLLDMVVASAGGNPYFLCEEK
VPLTKERSETKRCAQYRPLAPEEEVVRLVSSWSAEEGYVGRICFKLREEKLNEKNAAPEG
EEEWSVGGAREGAGGEGAAAAEDDVFLVQIHEVSPEQPHTVIKAPRYSTAQDIIQQTLFK
AKYSYSILSNPNPCDYVLMEEVTKDVGSKKSSTTKPLQRMLLDHECVYQAQSRWRGAGKF
ILKLKEQLVREDKKKVISFASELKKLTSRGRSMTTGGGVDGPGQRCWSAAVGLKVWVADG
RVGAGRFLPSSSSGRRLHPIHLPTSSLTAPVLKLHLLRNWKIHK
NT seq 6075 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatcagtgtgtactgggacaagagcgattgtccgagcgctgccctcaggacac
atatcagaggaggtctggaagtcggtgggcacttatagaaactggcgtcctactaagaag
gagataggaccaatcctgatgtgtggccgaagaaagaaagatgaattcagagtgtgcagg
gaaatgcagcgtctggtctggcctggaatcatggaccaaatggtcacctactatgtgcag
aacagaaagcagtatcctctgagtcatccatgccaaaagctgctgttgtcttgtcctgga
tgtgtgtgtctcagggtgtctctgtgcccagagacccccatcactgacagagcggacctg
agcccctgctgcagactgtggcgctgccatcctgctcacccacctggggtttatcgtgct
tgcctccagaggacttcgctgttttccctgctgactggagccctgctggaggctatagca
gctcttggtgcccgctctgcgttaccctactctttccctcagggctcgaacagccacgtc
gtgctgaaagagcgtcagctggccaacagcatgaccagcagcagtgcgctgtctcccgcc
gtcagcggcatcagtaaggagctggcagaaatgcggcaccttgttcagttccccgaggag
atcgcctgcatcctcactgagcaggagcagcagctctaccagcgggttttccccctggac
tacctctgtttccttacaagagacctgggcagtcccgagtgtcaaagcaaacatcaccca
agccttaaggcgtcactttctgtgccagccatgtctacacagagctctcgacacaatgca
gtggaggacctggtggcacgcttcaatgaggtgagctcatgggtaacctggctgattctg
acagcagggtccatggaagagaagagagaggtcttctcctatctggtcaatgttgccaag
tgctgttggaacatgggcaattacaatggcgtcatggagttcctggctggactcaggtcc
cgtaaggtgctgaaaatgtggcaatttatggaccagactgacatcgagaccatgcgtagc
ctgaaggatgctatggctcaacatgaatcctcctctgagtacaagaaggttgtgaccaga
gctctcaacatcccaggatgtaaggtggtgcctttctgtggggtctttctaaaggagctg
agtgatgcactggatggaacagcaagcataatcagcctgaaatctcctctggagaattca
gaagactcaatagagtttgtttcagactatagcggccagcacaacttcctgttgcggtct
ggtcctgatggtctacacatcccagagaaagaagctactgtcagtaacattctccagatt
atcagatcctgtaatcgtagtttggaggtggaagacactgatgatggctcaaccagccct
tcttctagttgtccactccccacttccagaaacaactccttcaaggaccgctgccgtaat
cagttcatggtgggagacttgtcagattcagacggagacctgccatctgagcctgcagtg
aaagagggggagtttcaggggactgaagaaacacacaaggctttcaaccatggcaccgag
ctcattccctggtacgtgttatcgctgcagccggatgttcaccagtttctgctgcagggg
gccacggtcatccactacgaccaggacagccacctctcagcacgctgtctgctgcggctg
cagcccgacaacacaacgctcacctggggtaacccacagaaaggtggggcctcccccaca
gagccaccactgggattaggacaggccgtcgtcgcaggactagccgaggggcttttggac
cttggagtggtgaaggcagtgttcctaggtcatcagggagtcgatgttcatgctgtatgt
ctgcaaaacaagctgagccacatgacagtggaggagaacaccctgagcctcctctatggt
gtcagtaccactgacaacagacttctgcactttgtggctccaaaccacaccacgcaaatg
ctccataaaggtttgtcagagttggtgacggccacacggaaattgaagaagtttcctgat
cagcggttgcagtggctgcggaggcagtatgtcagtttatatcaggaggatggcaggtat
gaagggcccacattagcccaagccattgagctgtttggaggccggagatggaacatgagc
acaggtggaacagagaaatctgcccatcagaaaaacagtcctttgagcatcaacgataag
accaagaagaagaagaaggtcctcgtcaggggagacagtggagatgccactgacgatgag
atggttgctcggaaaacacggagctgtaaggaaggaacatatcgaaacggaccggagtct
gacagtatagatcacgaagacccagaagatagcttcccgggaccattctccctctcaacc
aataaaagtcctggattgcaagcctcttcttcttcctcctcctcctcttccagcatgact
ggctccaatcagtctcgcccacagtcctccccaaccctctcaggaacagtgaaagcacag
ccaggggcgtggagcagcaggtcatggcatggtcgtggtaaaggctgcttcagaggcttc
cagaacctcatgatctctgacagcacaatgagctttgttgagtttgtggagcttttcaag
tcattcagtatccgaagcaggaaggatctgaaggaactgtttgacacctttgctgtgccc
tgcattcgctcagatccagagtctgttcctctttacaccaatctcaggatagatgacaaa
gacacaggtctacagccggacctcgatttattaacgcgcaatggttcggatcttggtctg
tttatccgaacgaggcagcagatgtctgacaaccagaagcagatctcagacgccattgca
gcagccagcattgtgaccaacgggacgggagtagaaaacgcatcactgggggttttggga
ctgggcatccctcaacttaacgacttcttggtcaactgtcagagagaacatctgagctat
gatgagatcctcagcattatacagaagtttgaaccctcatcaagcatgagacaaatgggg
tggatgtcattcgaaggcttttcaaggttcctgatggataaggataactttgcctcacac
attgaggaatcccagatgaacccggaggaactgcagcatcccctgtcttattactacatt
cagtcttctcacaatacttatctgactgggcaccagcttaaaggggagtcctctgttgag
ctttacagtcaggtgcttttgcaaggctgcagaagtgtggagctggactgttgggatgga
gatgatggcatgccggttatttatcacggacacactcttaccaccaagataccatttaag
gatgtggtggaagcaattagcaggtctgcatttgtcaactccaacatgcccgtcgtcctg
tctatagagaaccactgctccctcccgcagcagcgcaagatggcggaaatcttcaagacg
gtgtttggggagcgtctggtgacacgcttcctctttgaaagcgacttcagcgatgaccct
cacctgccatctccactgcagctgcaggggaggattctcctcaagaataagaagctgaaa
gcacaccaggctccggtggacatactcaagcagaaggctcaccagcttgcccacatgcag
gcccaggttagcaatggttcaccaggggtttcctctcccgggacccaaaccaacgaggac
gaggaagaggaagaagacgagtacgactatgactatgagtctctctcagatgacaacctc
ctggatgacaaacctgaggtgaaaagctcagctgacaaagaggagcagcctgtggatgaa
atacccaagagaatgaagaagcctgacaacactacgcagagtaaaggaaaggtgtttgac
atggaactgggcgaggagttctaccttccacagaacaaaaaggaaagtcgacagatcgct
caggagctgtctgacctcgtcatctactgtcaggccgtgaagttccctggtctgtccacg
ctgtctccggctggctccggcagagggaaagaccgtggaaagagcaggaagtccatattt
ggcacggctccagctcgctgcagcgcaacaggggaggtcaccactccgagtcgcacccct
gggaaaggtggcgccgagcgcctgagctgggaagagcagcaaacgtctcctgtcctcagt
ccacccacctctctcagcgccattatccgtacacccaagtgttatcacatctcctccgtc
aatgagaacgccgccaagcgactgtgccggcgttactctcagaaactgatccagcacacc
gtgtgtcagctgctcaggacttacccagcagccaccaggatcgactccacaaacccaaac
cctctgctgttctggctgcatggcattcagctggtggctctcaactatcagactgacgac
ctgcccatgcagttaaacacagctctgtttgaggccaacggcggctgcggctatgtcctg
aaaccagcggtgctgtgggaccgaaactgtccgatgtatcagcagttctgtccgatggag
agggatgtggaaaaaatgagtcctgccgtctactcccttgctatcgtttcggggcagaac
gtctgtcccggtaacagcagcggcagcccctgcatcgaggtggacgtcctggggatgccg
gtcgacagcgcccacttccgtaccaaacccatccaccgcaacaccctcaaccccatgtgg
aacgagcactttcagttcaccgtgcactttgaagagatgtgcttcttgcgcgttgctgtt
gtggagaacaacagttcccagactactgctcagagaactctacctctgaaagccctcaag
tcaggttacagacacatccagctgaggactcaacacaatgaatctctggaagtgtcaagc
ttgttcatctatagccgaaggacagaggagtgtccgacagggggcgacattccctcatcc
ctgctgttcagctctgaggagaagcctgcatcccagcagcacagggtgacggtgtacgga
gctcctggtcctgagcccttcactgtgttcagtgtgacggagcagatcactgccaaacag
ctgctggacatggtcgtagcttctgctggtggaaatccctacttcctgtgtgaggagaag
gttcctttgacgaaggagcgcagtgagacaaaacgctgtgctcagtatcgcccccttgct
ccggaggaggaggtggtccgactggtttccagctggagtgccgaggagggatatgtggga
aggatctgcttcaagctcagagaggagaaattaaatgagaagaacgcagcaccagaagga
gaggaggagtggagtgtgggcggagccagggagggagctggtggagaaggagcagcagca
gcagaggatgatgtgttcctggtccagatccatgaagtttctccagagcagcctcacact
gtgatcaaggccccgcgctacagcacagctcaggacatcatccagcagacgttattcaag
gccaagtattcctacagcatcctctccaatcccaatccatgcgactacgtcctaatggag
gaagtaaccaaagacgtgggctcaaagaagtcctccaccactaagcccctgcagcggatg
ctgctggatcacgagtgcgtctatcaggctcagagccgctggcggggcgcggggaagttc
attctgaaactgaaagagcagttggtgcgggaagacaaaaagaaagtcatttcctttgcc
agtgagctgaagaaactgacgagccgcggccgcagcatgacgactggcggcggcgtggac
ggccccggccagaggtgttggtctgcagcagtcggtctgaaggtgtgggtggcagatgga
agggtgggggcaggtagattccttccatcttcctcctctgggagacgtcttcatccaatc
cacctgcccacctcctctctgactgcaccagtgttgaagctgcacctcctcaggaactgg
aagatccacaaatga

DBGET integrated database retrieval system