KEGG   Takifugu rubripes (torafugu): 101065955Help
Entry
101065955         CDS       T02386                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1-like
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tru00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:tru04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:tru04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 2276 aa AA seqDB search
MSTKASQTPAEAAVVDRCSTAPSSSSKPTREVRNTNANQELQRYYDQLWNSNQRSSPPLI
FYRKLPCDGEKGLIPNEALSNACLDRSSGGCEEPYQELSTGTDGIANVVPLISSEGTPCQ
LDSPGEGGQADRNRTGSSHCSSTMSTPQMIPNIDCCLSHTSSHLSPVHSPCFGSSPTQQK
QRRGRRSSLPVSMMAFHKQRHREGHFQRYRSKDGYSSLERLNRRPRVNKHSLQKLFPRRA
SLQTVITTGRSGLSSSPGSRDCSEDSSGSGSDGDGDGDGEELLDHTEFIRNRKERSTVLV
RRFYKNNQKMTKSVCTGTRAIVRALPSGHISEEVWKSVGTYRNWRPTKKEIGPILMCGRR
KKDEFRVCREMQRLVWPGIMDQMLGGIELKGYISFWVSLCPETPITDRADLSPCCRLWRC
HPAHPPGVYRACLQRTSLFSLLTGALLEAIAALGARSALPYSFPQGSNSHVVLKERQLAN
SMTSSSALSPAVSGISKELAEMRHLVQFPEEIACILTEQEQQLYQRVFPLDYLCFLTRDL
GSPECQSKHHPSLKASLSVPAMSTQSSRHNAVEDLVARFNEVSSWVTWLILTAGSMEEKR
EVFSYLVNVAKCCWNMGNYNGVMEFLAGLRSRKVLKMWQFMDQTDIETMRSLKDAMAQHE
SSSEYKKVVTRALNIPGCKVVPFCGVFLKELSDALDGTASIISLKSPLENSEDSIEFVSD
YSGQHNFLLRSGPDGLHIPEKEATVSNILQIIRSCNRSLEVEDTDDGSTSPSSSCPLPTS
RNNSFKDRCRNQFMVGDLSDSDGDLPSEPAVKEGEFQGTEETHKAFNHGTELIPWYVLSL
QPDVHQFLLQGATVIHYDQDSHLSARCLLRLQPDNTTLTWGNPQKGGASPTEPPLGLGQA
VVAGLAEGLLDLGVVKAVFLGHQGVDVHAVCLQNKLSHMTVEENTLSLLYGVSTTDNRLL
HFVAPNHTTQMLHKGLSELVTATRKLKKFPDQRLQWLRRQYVSLYQEDGRYEGPTLAQAI
ELFGGRRWNMSTGGTEKSAHQKNSPLSINDKTKKKKKVLVRGDSGDATDDEMVARKTRSC
KEGTYRNGPESDSIDHEDPEDSFPGPFSLSTNKSPGLQASSSSSSSSSSMTGSNQSRPQS
SPTLSGTVKAQPGAWSSRSWHGRGKGCFRGFQNLMISDSTMSFVEFVELFKSFSIRSRKD
LKELFDTFAVPCIRSDPESVPLYTNLRIDDKDTGLQPDLDLLTRNGSDLGLFIRTRQQMS
DNQKQISDAIAAASIVTNGTGVENASLGVLGLGIPQLNDFLVNCQREHLSYDEILSIIQK
FEPSSSMRQMGWMSFEGFSRFLMDKDNFASHIEESQMNPEELQHPLSYYYIQSSHNTYLT
GHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAISRS
AFVNSNMPVVLSIENHCSLPQQRKMAEIFKTVFGERLVTRFLFESDFSDDPHLPSPLQLQ
GRILLKNKKLKAHQAPVDILKQKAHQLAHMQAQVSNGSPGVSSPGTQTNEDEEEEEDEYD
YDYESLSDDNLLDDKPEVKSSADKEEQPVDEIPKRMKKPDNTTQSKGKVFDMELGEEFYL
PQNKKESRQIAQELSDLVIYCQAVKFPGLSTLSPAGSGRGKDRGKSRKSIFGTAPARCSA
TGEVTTPSRTPGKGGAERLSWEEQQTSPVLSPPTSLSAIIRTPKCYHISSVNENAAKRLC
RRYSQKLIQHTVCQLLRTYPAATRIDSTNPNPLLFWLHGIQLVALNYQTDDLPMQLNTAL
FEANGGCGYVLKPAVLWDRNCPMYQQFCPMERDVEKMSPAVYSLAIVSGQNVCPGNSSGS
PCIEVDVLGMPVDSAHFRTKPIHRNTLNPMWNEHFQFTVHFEEMCFLRVAVVENNSSQTT
AQRTLPLKALKSGYRHIQLRTQHNESLEVSSLFIYSRRTEECPTGGDIPSSLLFSSEEKP
ASQQHRVTVYGAPGPEPFTVFSVTEQITAKQLLDMVVASAGGNPYFLCEEKVPLTKERSE
TKRCAQYRPLAPEEEVVRLVSSWSAEEGYVGRICFKLREEKLNEKNAAPEGEEEWSVGGA
REGAGGEGAAAAEDDVFLVQIHEVSPEQPHTVIKAPRYSTAQDIIQQTLFKAKYSYSILS
NPNPCDYVLMEEVTKDVGSKKSSTTKPLQRMLLDHECVYQAQSRWRGAGKFILKLKEQVA
PSLVREDKKKVISFASELKKLTSRGRSMTTGGGVDGPGQSKDDRAACCVALTELQE
NT seq 6831 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaaagctagtcagaccccagctgaagctgcagtcgtggatcggtgcagcacg
gctccatcgagtagcagcaaacccaccagggaggtcagaaataccaacgccaaccaagaa
ttacagcgatactatgatcagctgtggaattcaaatcagcggagcagcccaccgctgatc
ttctacaggaagttgccctgtgacggtgagaaagggctcatcccaaatgaggccctttca
aacgcctgtttagaccgcagctcagggggctgtgaggaaccttatcaagagctctcaact
ggtactgacggaatagccaatgtggttcctctgataagttcagagggaacaccgtgccag
ctggacagtccaggagagggtggccaagcagacagaaacagaactggcagcagccactgc
tcctctactatgtctacccctcaaatgatcccaaatatcgactgttgcctgagccacaca
tccagtcatctgagccctgtgcacagcccttgcttcggctccagccccacgcagcaaaaa
cagcgacgtggccgacgcagcagcttgcccgtgtccatgatggctttccataagcagcgc
catcgagaaggccacttccaacgataccgcagcaaagatggctactccagtttggagagg
ctcaaccgaaggcccagggttaacaaacactccctccagaaattattcccacggagggca
tcgctgcaaactgtaatcaccactgggaggagcgggctgtcatcctcaccggggagcaga
gactgcagcgaggacagcagcggcagcggcagcgacggggacggggacggggacggggag
gaactgttagaccacacagagttcattaggaaccgtaaagaacgctccactgtcctggtg
aggcgcttctacaaaaataatcaaaagatgactaaatcagtgtgtactgggacaagagcg
attgtccgagcgctgccctcaggacacatatcagaggaggtctggaagtcggtgggcact
tatagaaactggcgtcctactaagaaggagataggaccaatcctgatgtgtggccgaaga
aagaaagatgaattcagagtgtgcagggaaatgcagcgtctggtctggcctggaatcatg
gaccaaatgcttggaggaattgaactgaagggttacatttctttctgggtgtctctgtgc
ccagagacccccatcactgacagagcggacctgagcccctgctgcagactgtggcgctgc
catcctgctcacccacctggggtttatcgtgcttgcctccagaggacttcgctgttttcc
ctgctgactggagccctgctggaggctatagcagctcttggtgcccgctctgcgttaccc
tactctttccctcagggctcgaacagccacgtcgtgctgaaagagcgtcagctggccaac
agcatgaccagcagcagtgcgctgtctcccgccgtcagcggcatcagtaaggagctggca
gaaatgcggcaccttgttcagttccccgaggagatcgcctgcatcctcactgagcaggag
cagcagctctaccagcgggttttccccctggactacctctgtttccttacaagagacctg
ggcagtcccgagtgtcaaagcaaacatcacccaagccttaaggcgtcactttctgtgcca
gccatgtctacacagagctctcgacacaatgcagtggaggacctggtggcacgcttcaat
gaggtgagctcatgggtaacctggctgattctgacagcagggtccatggaagagaagaga
gaggtcttctcctatctggtcaatgttgccaagtgctgttggaacatgggcaattacaat
ggcgtcatggagttcctggctggactcaggtcccgtaaggtgctgaaaatgtggcaattt
atggaccagactgacatcgagaccatgcgtagcctgaaggatgctatggctcaacatgaa
tcctcctctgagtacaagaaggttgtgaccagagctctcaacatcccaggatgtaaggtg
gtgcctttctgtggggtctttctaaaggagctgagtgatgcactggatggaacagcaagc
ataatcagcctgaaatctcctctggagaattcagaagactcaatagagtttgtttcagac
tatagcggccagcacaacttcctgttgcggtctggtcctgatggtctacacatcccagag
aaagaagctactgtcagtaacattctccagattatcagatcctgtaatcgtagtttggag
gtggaagacactgatgatggctcaaccagcccttcttctagttgtccactccccacttcc
agaaacaactccttcaaggaccgctgccgtaatcagttcatggtgggagacttgtcagat
tcagacggagacctgccatctgagcctgcagtgaaagagggggagtttcaggggactgaa
gaaacacacaaggctttcaaccatggcaccgagctcattccctggtacgtgttatcgctg
cagccggatgttcaccagtttctgctgcagggggccacggtcatccactacgaccaggac
agccacctctcagcacgctgtctgctgcggctgcagcccgacaacacaacgctcacctgg
ggtaacccacagaaaggtggggcctcccccacagagccaccactgggattaggacaggcc
gtcgtcgcaggactagccgaggggcttttggaccttggagtggtgaaggcagtgttccta
ggtcatcagggagtcgatgttcatgctgtatgtctgcaaaacaagctgagccacatgaca
gtggaggagaacaccctgagcctcctctatggtgtcagtaccactgacaacagacttctg
cactttgtggctccaaaccacaccacgcaaatgctccataaaggtttgtcagagttggtg
acggccacacggaaattgaagaagtttcctgatcagcggttgcagtggctgcggaggcag
tatgtcagtttatatcaggaggatggcaggtatgaagggcccacattagcccaagccatt
gagctgtttggaggccggagatggaacatgagcacaggtggaacagagaaatctgcccat
cagaaaaacagtcctttgagcatcaacgataagaccaagaagaagaagaaggtcctcgtc
aggggagacagtggagatgccactgacgatgagatggttgctcggaaaacacggagctgt
aaggaaggaacatatcgaaacggaccggagtctgacagtatagatcacgaagacccagaa
gatagcttcccgggaccattctccctctcaaccaataaaagtcctggattgcaagcctct
tcttcttcctcctcctcctcttccagcatgactggctccaatcagtctcgcccacagtcc
tccccaaccctctcaggaacagtgaaagcacagccaggggcgtggagcagcaggtcatgg
catggtcgtggtaaaggctgcttcagaggcttccagaacctcatgatctctgacagcaca
atgagctttgttgagtttgtggagcttttcaagtcattcagtatccgaagcaggaaggat
ctgaaggaactgtttgacacctttgctgtgccctgcattcgctcagatccagagtctgtt
cctctttacaccaatctcaggatagatgacaaagacacaggtctacagccggacctcgat
ttattaacgcgcaatggttcggatcttggtctgtttatccgaacgaggcagcagatgtct
gacaaccagaagcagatctcagacgccattgcagcagccagcattgtgaccaacgggacg
ggagtagaaaacgcatcactgggggttttgggactgggcatccctcaacttaacgacttc
ttggtcaactgtcagagagaacatctgagctatgatgagatcctcagcattatacagaag
tttgaaccctcatcaagcatgagacaaatggggtggatgtcattcgaaggcttttcaagg
ttcctgatggataaggataactttgcctcacacattgaggaatcccagatgaacccggag
gaactgcagcatcccctgtcttattactacattcagtcttctcacaatacttatctgact
gggcaccagcttaaaggggagtcctctgttgagctttacagtcaggtgcttttgcaaggc
tgcagaagtgtggagctggactgttgggatggagatgatggcatgccggttatttatcac
ggacacactcttaccaccaagataccatttaaggatgtggtggaagcaattagcaggtct
gcatttgtcaactccaacatgcccgtcgtcctgtctatagagaaccactgctccctcccg
cagcagcgcaagatggcggaaatcttcaagacggtgtttggggagcgtctggtgacacgc
ttcctctttgaaagcgacttcagcgatgaccctcacctgccatctccactgcagctgcag
gggaggattctcctcaagaataagaagctgaaagcacaccaggctccggtggacatactc
aagcagaaggctcaccagcttgcccacatgcaggcccaggttagcaatggttcaccaggg
gtttcctctcccgggacccaaaccaacgaggacgaggaagaggaagaagacgagtacgac
tatgactatgagtctctctcagatgacaacctcctggatgacaaacctgaggtgaaaagc
tcagctgacaaagaggagcagcctgtggatgaaatacccaagagaatgaagaagcctgac
aacactacgcagagtaaaggaaaggtgtttgacatggaactgggcgaggagttctacctt
ccacagaacaaaaaggaaagtcgacagatcgctcaggagctgtctgacctcgtcatctac
tgtcaggccgtgaagttccctggtctgtccacgctgtctccggctggctccggcagaggg
aaagaccgtggaaagagcaggaagtccatatttggcacggctccagctcgctgcagcgca
acaggggaggtcaccactccgagtcgcacccctgggaaaggtggcgccgagcgcctgagc
tgggaagagcagcaaacgtctcctgtcctcagtccacccacctctctcagcgccattatc
cgtacacccaagtgttatcacatctcctccgtcaatgagaacgccgccaagcgactgtgc
cggcgttactctcagaaactgatccagcacaccgtgtgtcagctgctcaggacttaccca
gcagccaccaggatcgactccacaaacccaaaccctctgctgttctggctgcatggcatt
cagctggtggctctcaactatcagactgacgacctgcccatgcagttaaacacagctctg
tttgaggccaacggcggctgcggctatgtcctgaaaccagcggtgctgtgggaccgaaac
tgtccgatgtatcagcagttctgtccgatggagagggatgtggaaaaaatgagtcctgcc
gtctactcccttgctatcgtttcggggcagaacgtctgtcccggtaacagcagcggcagc
ccctgcatcgaggtggacgtcctggggatgccggtcgacagcgcccacttccgtaccaaa
cccatccaccgcaacaccctcaaccccatgtggaacgagcactttcagttcaccgtgcac
tttgaagagatgtgcttcttgcgcgttgctgttgtggagaacaacagttcccagactact
gctcagagaactctacctctgaaagccctcaagtcaggttacagacacatccagctgagg
actcaacacaatgaatctctggaagtgtcaagcttgttcatctatagccgaaggacagag
gagtgtccgacagggggcgacattccctcatccctgctgttcagctctgaggagaagcct
gcatcccagcagcacagggtgacggtgtacggagctcctggtcctgagcccttcactgtg
ttcagtgtgacggagcagatcactgccaaacagctgctggacatggtcgtagcttctgct
ggtggaaatccctacttcctgtgtgaggagaaggttcctttgacgaaggagcgcagtgag
acaaaacgctgtgctcagtatcgcccccttgctccggaggaggaggtggtccgactggtt
tccagctggagtgccgaggagggatatgtgggaaggatctgcttcaagctcagagaggag
aaattaaatgagaagaacgcagcaccagaaggagaggaggagtggagtgtgggcggagcc
agggagggagctggtggagaaggagcagcagcagcagaggatgatgtgttcctggtccag
atccatgaagtttctccagagcagcctcacactgtgatcaaggccccgcgctacagcaca
gctcaggacatcatccagcagacgttattcaaggccaagtattcctacagcatcctctcc
aatcccaatccatgcgactacgtcctaatggaggaagtaaccaaagacgtgggctcaaag
aagtcctccaccactaagcccctgcagcggatgctgctggatcacgagtgcgtctatcag
gctcagagccgctggcggggcgcggggaagttcattctgaaactgaaagagcaggtagct
cccagcttggtgcgggaagacaaaaagaaagtcatttcctttgccagtgagctgaagaaa
ctgacgagccgcggccgcagcatgacgactggcggcggcgtggacggccccggccagagt
aaggatgatagagctgcatgttgtgtggctctgacagagctccaggagtga

DBGET integrated database retrieval system