KEGG   Takifugu rubripes (torafugu): 101066005Help
Entry
101066005         CDS       T02386                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3-A-like
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101066005
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101066005
   04070 Phosphatidylinositol signaling system
    101066005
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101066005
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101066005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 794 aa AA seqDB search
MSTASPVREERAICSDMLGSIAAQGEALRSGAGTSRSIDPLRSLGVQDDEDVKQMLQGSS
MLKVRSAHWQKRRTLKLLEDGVTIWCQSHKTSSRAKEQQSFSVMEVECVLEGCQSETFRQ
MVGSVPEGHSLTVVFKGPRKSLDLLCQNQEEARCWARGIRTLQEHVENMTQKEKLNHWIH
AYLSQADKNHDDKMSYNEVRTLLQMINIDLSDQYALSLFQKCDKSADGRLDHEEIEVFCR
ELLRRPELDAVFIQYSANGCVLSTLDLRDFLLDQEEDASLIHAQSLILTYELNVWAQKNQ
FMTPNGFTMYMLSKENCIFNAEHARVYQDMTHPLADYFVSSSHNTYLTKNQLTGDSSTEP
YIRALNRGCRCVELDCWDGDKGEPVIYHGHTLTSKVPFVEVVQTIDEYAFKTSPYPLILS
LENHCSVEQQTVMARHLKTILGDKLLTKPLGDLNPQILPSPEDLKHKILVKGQKDHLVER
CSSDWSSSDEEAGCSEGKPSVKKQDRKPGVSKLSPELSELVVYTCSVPFKGFEQAAERPA
SEMSSFSESKALRLIKDSGIHFVRHNSHKLSRIYPSGQRLQSSNYNPQDMWNGGCQIVAL
NFQTPGEQMDLNQGRFLQNGQCGYNLKPAFMCQPDATFNPENVGGGSGHRPFLLSIRIIS
AQQLPKPEWDKPSSIVDPQVWVEIYGVPIDNMKKKTHHIENNGFNPRWDCTFNFTVHVPD
LALVRFKVEDHDYTSNNDFLGQYTLPFTALRTGYRHVRLMKMDGSSLSPSSLFIYVKVTM
CPSKSAAKPSFSKP
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagccagtccagtcagagaagaacgagcaatttgcagtgacatgctcggcagt
atagcggcccaaggagaggcgctgaggagcggagccgggacgtccaggagcatcgaccct
ctgaggagcctcggagtgcaagacgacgaggatgtgaagcagatgttgcagggctccagc
atgctgaaggtgcgctcagctcactggcagaagcgtcggacactgaagcttttggaggac
ggggtcactatctggtgtcagtcccacaaaacctctagtagagccaaagaacaacagtcc
ttttcagtcatggaagtggaatgtgttcttgagggctgtcagtcagagacttttcgacag
atggttggctccgtgccagagggccactctttgacagtggtcttcaaaggaccccggaag
agtttggatctcctctgccagaatcaggaagaggcccggtgctgggcccgtggcatacga
accctgcaggagcatgtagagaacatgactcagaaggaaaaactcaaccattggatccat
gcttacctaagtcaggctgacaaaaaccacgatgataagatgagctacaatgaggtgcgg
acacttctgcagatgatcaacattgacctgagcgaccagtatgctttaagcctcttccag
aaatgtgacaagtctgctgatggtcgtctggatcacgaggagatcgaggtgttctgcagg
gagttgctacgaagaccagagctggacgccgtgttcatccaatactctgccaacggctgc
gttctttccactctggacctcagagatttcttattggaccaggaggaggatgcttcactg
atccatgcccagagcctcatcctcacctatgaactcaacgtgtgggctcagaagaaccag
ttcatgacccccaatgggttcaccatgtacatgctatctaaggagaactgtatcttcaat
gcagaacatgctagagtttaccaggacatgactcatccacttgcagactattttgtctca
tcctctcataatacctacctcactaagaaccaactgaccggggacagtagcaccgagcca
tatatccgggcgctgaatcgtggttgccgttgtgttgagctggactgttgggatggagat
aaaggagaacctgtcatctaccacggacacacactcacctccaaagtaccctttgttgag
gttgttcagacaattgatgaatacgctttcaaaacatctccctaccctctaatattgtcc
ttggagaaccactgctctgtggagcagcaaacagtgatggctcgacacttgaagaccatc
cttggagacaagctgctcaccaaacctctcggagatttgaatccacaaattctaccttct
ccagaggatcttaaacataaaatcttggtgaaaggtcaaaaagaccatttggtagagagg
tgctcatcagactggagttcatcagatgaagaggcaggttgttctgaaggcaaaccctcc
gtcaagaaacaggacaggaagccaggggtgtctaagctgagcccagagctgtcagagttg
gtggtgtacacctgcagcgttccctttaaaggttttgaacaggctgcagaaaggcccgcc
tctgagatgtcctctttctctgaaagcaaagctctgagactcatcaaggactcagggatt
cattttgtccgtcacaacagtcacaagctgagcaggatctacccttcaggacagcgcctc
cagtcctcaaactacaaccctcaggatatgtggaatggaggctgtcagattgttgctttg
aacttccagacaccaggtgagcagatggacctaaaccagggcagattcctgcaaaacggc
cagtgtgggtacaacctgaagcctgcattcatgtgccagcctgacgccaccttcaaccct
gagaatgttggtggaggttcaggccacaggcccttcttacttagcatacggatcatctcg
gcacagcagctccctaaacctgaatgggacaagcccagttctattgtggatcctcaggtg
tgggtggagatttacggtgtcccgattgacaacatgaagaagaaaactcatcacattgaa
aataatggctttaatccaaggtgggactgtaccttcaacttcactgtccacgtcccggac
ctggctctggttcgctttaaggtggaggaccatgattacacctcaaacaatgacttcctg
ggtcaatacaccctgcctttcactgctctccgtacaggttaccgtcacgtccgtctgatg
aagatggatggctcaagcctttccccctcatcactctttatctacgttaaagtcaccatg
tgtccctctaagtcagcagcaaaaccatcgttcagcaagccctga

DBGET integrated database retrieval system