KEGG   Takifugu rubripes (torafugu): 101066049Help
Entry
101066049         CDS       T02386                                 

Definition
brain-derived neurotrophic factor-like
Orthology
K04355  
brain-derived neurotrophic factor
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tru04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 289 aa AA seqDB search
MQQCIVDQFHQVRRVMTILFLTMVISYFSCMRAAPLRDTPGMRGHRTEGYLGAAATAARG
HGTPQSGGGPGQHGDLPSLTDTFEQVIEELLEVEGEAAQLGQAAEKSQGGGGGGGGGPSS
MASADTKDVDLYSSRVMLSNQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPSRRGEL
SVCDSISQWVTAVDKKTAIDMSGQTVTVMEKVPVNNGQLKQYFYETKCNPMGYTKDGCRG
IDKRHYNSQCRTTQSYVRALTMDSKKKIGWRFIRIDTSCVCTLTIKRGR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagtgcattgtggatcaattccaccaggttagaagagtgatgaccatcctgttc
cttactatggttatttcatacttcagttgcatgagagctgcgcccctgagagacaccccg
ggcatgcggggccatcggacggaaggctacctgggcgccgctgccacggcagcgcgaggc
cacgggactccacagagcggtggcgggccgggccagcacggagatctgccctcgctgacg
gacacgttcgagcaggtgatcgaggagctgctggaggtggaaggggaagcggcgcagctg
ggacaggcggcggagaagagccaaggcggcggcggcggcggcggcggcggcccgtcctcc
atggcctcggcggacaccaaggatgtcgacctgtacagctcgcgcgtgatgctcagcaac
caagtgcctttggagccgccgttgctctttctcctggaggaatacaaaaactatctggat
gccgccaacatgtccatgagggtgcggcgacactccgacccctcgcgacgcggagagctc
agcgtgtgtgacagtattagccagtgggtgaccgctgtggacaaaaagacggcgatagac
atgtctgggcagacagttaccgtcatggagaaggtccctgtcaacaatggccaactgaag
caatacttttacgagaccaaatgcaaccccatggggtacacgaaggacggctgcagggga
atagacaagaggcattataattcccaatgcaggacaacccagtcctacgtgcgagcgctc
accatggatagcaaaaagaagattggctggcggtttataaggatagacacttcgtgtgta
tgcacattgaccataaaaagagggagatag

DBGET integrated database retrieval system