KEGG   Takifugu rubripes (torafugu): 101066049Help
Entry
101066049         CDS       T02386                                 

Gene name
bdnf
Definition
(RefSeq) brain-derived neurotrophic factor
  KO
K04355  
brain-derived neurotrophic factor
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101066049 (bdnf)
Cytokines [BR:tru04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    101066049 (bdnf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 274 aa AA seqDB search
MTILFLTMVISYFSCMRAAPLRDTPGMRGHRTEGYLGAAATAARGHGTPQSGGGPGQHGD
LPSLTDTFEQVIEELLEVEGEAAQLGQAAEKSQGGGGGGGGGPSSMASADTKDVDLYSSR
VMLSNQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPSRRGELSVCDSISQWVTAVDK
KTAIDMSGQTVTVMEKVPVNNGQLKQYFYETKCNPMGYTKDGCRGIDKRHYNSQCRTTQS
YVRALTMDSKKKIGWRFIRIDTSCVCTLTIKRGR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcctgttccttactatggttatttcatacttcagttgcatgagagctgcgccc
ctgagagacaccccgggcatgcggggccatcggacggaaggctacctgggcgccgctgcc
acggcagcgcgaggccacgggactccacagagcggtggcgggccgggccagcacggagat
ctgccctcgctgacggacacgttcgagcaggtgatcgaggagctgctggaggtggaaggg
gaagcggcgcagctgggacaggcggcggagaagagccaaggcggcggcggcggcggcggc
ggcggcccgtcctccatggcctcggcggacaccaaggatgtcgacctgtacagctcgcgc
gtgatgctcagcaaccaagtgcctttggagccgccgttgctctttctcctggaggaatac
aaaaactatctggatgccgccaacatgtccatgagggtgcggcgacactccgacccctcg
cgacgcggagagctcagcgtgtgtgacagtattagccagtgggtgaccgctgtggacaaa
aagacggcgatagacatgtctgggcagacagttaccgtcatggagaaggtccctgtcaac
aatggccaactgaagcaatacttttacgagaccaaatgcaaccccatggggtacacgaag
gacggctgcaggggaatagacaagaggcattataattcccaatgcaggacaacccagtcc
tacgtgcgagcgctcaccatggatagcaaaaagaagattggctggcggtttataaggata
gacacttcgtgtgtatgcacattgaccataaaaagagggagatag

DBGET integrated database retrieval system