KEGG   Takifugu rubripes (torafugu): 101066123Help
Entry
101066123         CDS       T02386                                 

Definition
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3, mitochondrial-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 406 aa AA seqDB search
MRIFTFLLKNVNPKIEYYSRFSPSPLSIKQFLDFGRENACEKTSYMFLRKELPVRLANTM
KEVNLLPDKLLSQPSVKLVQKWYMQSFVELLDYENRNPEDSHTLNDFLELLIEIRNRHND
VVPTMAQGVIEYKEKFGFDPFISSNVQYFLDRFYTNRISFRMLINQHTLLFGNDTNPAHP
KHIGSIDPTCSVAEVVSDAYDTAKMLCEKYYLAAPKLKIEEFNTKAAGKPIQVVYVPSHL
FHMLFELFKNSMRATVELHETSREGLPPVKAKVTLGKEDLSIKISDRGGGVPLRKIDRLF
HYMYSTAPTPSLEHGAVPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALS
SESFERLPVFNKSAWRHYKTSAEADDWSNPSKEPRDASKSNYKANR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaggattttcacgtttctgctgaaaaacgtcaaccctaaaatcgaatattactccagg
ttttcgccctctccgctctccattaagcagtttctggattttggcagggaaaatgcatgt
gagaaaacatcctacatgttcctgcgtaaggagctgcccgtacggctggccaacaccatg
aaagaggtcaaccttttgcccgacaagctgctcagccagccttctgttaaactagtgcag
aaatggtacatgcagagctttgttgagctgctggattatgaaaacagaaacccagaggat
tctcacactctaaatgacttcctggagcttctgattgaaatccgtaaccgtcacaatgac
gtagttcccactatggctcaaggggtcatcgagtacaaggagaaatttggcttcgacccc
ttcatcagcagcaacgtccagtacttcctcgaccgcttctacaccaaccgcatctctttc
cgcatgctcatcaaccagcacactctcctgtttggcaatgacaccaaccctgcccacccc
aaacacattggaagcatcgatcccacctgcagtgtggcggaagttgttagcgatgcctac
gacaccgccaagatgctgtgtgagaaatactacctggctgctccgaagctgaagatcgaa
gaatttaacacaaaggcagctggaaagcctatccaggttgtgtacgtgccgtcccatctg
ttccacatgctgtttgagctcttcaagaactcaatgagagccacagtggagctccacgag
accagcagagaggggttaccacctgtgaaagccaaagtcaccctgggtaaagaagatctg
tctataaagatcagtgaccgaggaggaggagtcccactgaggaagatagatcgcctgttt
cactacatgtactccaccgctcccacgccaagtctggaacatggagctgtccctctggct
ggttttggctacggtttgccaatttcaaggctctatgcccgatattttcaaggtgatctg
aaactgtactccatggagggcgtagggacggatgcagtcatctatctgaaggccctgtcc
agcgagtccttcgagcgccttcctgtcttcaacaagtccgcctggcgacattacaagacc
agtgccgaggcggacgactggagcaaccccagcaaagagccgcgcgatgccagcaagtcc
aactacaaagccaacagataa

DBGET integrated database retrieval system