KEGG   Takifugu rubripes (torafugu): 101066213Help
Entry
101066213         CDS       T02386                                 

Gene name
elp3
Definition
(RefSeq) elongator acetyltransferase complex subunit 3
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101066213 (elp3)
Transfer RNA biogenesis [BR:tru03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101066213 (elp3)
Chromosome and associated proteins [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101066213 (elp3)
   HAT complexes
    Elongator complex
     101066213 (elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 101066213
NCBI-ProteinID: XP_003971421
Position
16
AA seq 553 aa AA seqDB search
MGKPKKKSDLSRAELMMMTIADVIKQLVEAHEDGKDINLNRVKTKTSAKYGLQAQPRLVD
IIAAVPPQYRRALVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSD
FEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMSLPE
DYRDYFIRNLHDALSGHTSNNVAEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLGYG
CTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLSKDAGFKVVAHMMPDLPNVGMERDIE
QFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYTPSDLVDLVARILALVPPW
TRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHHKVRPYQ
VELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPELKGGVSIVRELHVYG
SVVPVSSRDPSKFQHQGFGMMLMEEAERIARDEHGSNRLAVISGVGTRNYYRKMGYELEG
PYMVKHLCEPGTD
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggggaagccaaagaaaaagagtgacctcagcagagctgagctgatgatgatgaccatc
gccgacgtcatcaagcagctagtggaggcccatgaagacggcaaagatatcaacctaaac
agagtaaagacaaagacttcagctaaatatggactccaggcgcagccccgactggtggac
atcattgctgccgttccgccacaatatcgccgtgctctggtgcccaaactgaaggccaaa
ccgatccgcaccgccagtgggatcgcagtcgtggctgtgatgtgtaaaccacatcgatgt
cctcacatcagctttacaggcaacatctgtgtctattgtccaggaggtccagactcagac
tttgagtactccacacagtcttacactggctatgagccgacctccatgagggctatccga
gcacgttacgacccctatcttcagacgcgacatcgggtggagcagttgaagcagcttggt
cacagtgtggacaaggtggagttcattgtgatgggaggcaccttcatgtccctgccagag
gactacagagactacttcatcagaaacctgcacgatgcattatcaggacacacctccaac
aatgtggccgaggccgtcaggtactcggagcgcagtaacaccaagtgtgtgggcatcacc
atcgagacgcggcccgactactgcctgaagaggcacctcagcgacatgttgggctacggc
tgcacccggctggagataggagtccagagcgtgtatgaagacgtggcccgcgacacaaac
aggggccacacggtgcgagctgtgtgtgagtcttttcacctctcaaaggacgctggcttc
aaagtggttgctcacatgatgccggatctacctaacgtgggcatggagagggacatagag
cagtttatcgagtttttcgagaatccggcgttcaggccggatgggctgaagctgtaccca
acgctggtgatccgaggcacgggtctgtacgagctgtggaagaccggccgctacaaaagc
tacacgcccagcgatctcgtggacctggtggccagaattctggcgctggtgccaccctgg
acgcgcgtctacagagtgcagagggacatccccatgccacttgtgagctcgggggtggag
cacggaaacctgagagagttggcgctggcgcgaatgaaggacatgggcaccgagtgtcga
gacgtcaggacccgagaagtcgggattcaggaaatccaccacaaagtccggccgtaccag
gtggagctgatacggagggactacgtggccaacggcggctgggagaccttcctctcctac
gaggaccccgagcaggacatcctgatcggcctgctgcgtctgcgccgctgctcacctcag
tccttccgtccagagctgaaagggggcgtgtctatcgtgcgagagctccacgtttacggg
agcgtcgtccccgtcagcagtcgagaccccagcaaattccagcaccagggttttggaatg
atgctgatggaggaggcggagaggatcgccagggacgaacacggatccaacagactggct
gtaatctcaggtgtaggaacacgcaactactacaggaagatgggttatgagctggagggc
ccctatatggtgaagcacctgtgtgaacctggaacagactga

DBGET integrated database retrieval system