KEGG   Takifugu rubripes (torafugu): 101066213Help
Entry
101066213         CDS       T02386                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101066213
Transfer RNA biogenesis [BR:tru03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101066213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 553 aa AA seqDB search
MGKPKKKSDLSRAELMMMTIADVIKQLVEAHEDGKDINLNRVKTKTSAKYGLQAQPRLVD
IIAAVPPQYRRALVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSD
FEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMSLPE
DYRDYFIRNLHDALSGHTSNNVAEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLGYG
CTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLSKDAGFKVVAHMMPDLPNVGMERDIE
QFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYTPSDLVDLVARILALVPPW
TRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHHKVRPYQ
VELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPELKGGVSIVRELHVYG
SVVPVSSRDPSKFQHQGFGMMLMEEAERIARDEHGSNRLAVISGVGTRNYYRKMGYELEG
PYMVKHLCEPGTD
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggggaagccaaagaaaaagagtgacctcagcagagctgagctgatgatgatgaccatc
gccgacgtcatcaagcagctagtggaggcccatgaagacggcaaagatatcaacctaaac
agagtaaagacaaagacttcagctaaatatggactccaggcgcagccccgactggtggac
atcattgctgccgttccgccacaatatcgccgtgctctggtgcccaaactgaaggccaaa
ccgatccgcaccgccagtgggatcgcagtcgtggctgtgatgtgtaaaccacatcgatgt
cctcacatcagctttacaggcaacatctgtgtctattgtccaggaggtccagactcagac
tttgagtactccacacagtcttacactggctatgagccgacctccatgagggctatccga
gcacgttacgacccctatcttcagacgcgacatcgggtggagcagttgaagcagcttggt
cacagtgtggacaaggtggagttcattgtgatgggaggcaccttcatgtccctgccagag
gactacagagactacttcatcagaaacctgcacgatgcattatcaggacacacctccaac
aatgtggccgaggccgtcaggtactcggagcgcagtaacaccaagtgtgtgggcatcacc
atcgagacgcggcccgactactgcctgaagaggcacctcagcgacatgttgggctacggc
tgcacccggctggagataggagtccagagcgtgtatgaagacgtggcccgcgacacaaac
aggggccacacggtgcgagctgtgtgtgagtcttttcacctctcaaaggacgctggcttc
aaagtggttgctcacatgatgccggatctacctaacgtgggcatggagagggacatagag
cagtttatcgagtttttcgagaatccggcgttcaggccggatgggctgaagctgtaccca
acgctggtgatccgaggcacgggtctgtacgagctgtggaagaccggccgctacaaaagc
tacacgcccagcgatctcgtggacctggtggccagaattctggcgctggtgccaccctgg
acgcgcgtctacagagtgcagagggacatccccatgccacttgtgagctcgggggtggag
cacggaaacctgagagagttggcgctggcgcgaatgaaggacatgggcaccgagtgtcga
gacgtcaggacccgagaagtcgggattcaggaaatccaccacaaagtccggccgtaccag
gtggagctgatacggagggactacgtggccaacggcggctgggagaccttcctctcctac
gaggaccccgagcaggacatcctgatcggcctgctgcgtctgcgccgctgctcacctcag
tccttccgtccagagctgaaagggggcgtgtctatcgtgcgagagctccacgtttacggg
agcgtcgtccccgtcagcagtcgagaccccagcaaattccagcaccagggttttggaatg
atgctgatggaggaggcggagaggatcgccagggacgaacacggatccaacagactggct
gtaatctcaggtgtaggaacacgcaactactacaggaagatgggttatgagctggagggc
ccctatatggtgaagcacctgtgtgaacctggaacagactga

DBGET integrated database retrieval system