KEGG   Takifugu rubripes (torafugu): 101066438Help
Entry
101066438         CDS       T02386                                 

Definition
thymosin beta-like
Orthology
K05764  
thymosin, beta 4
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101066438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 45 aa AA seqDB search
MSDKPDMTEIANFDKTKLKKTETKEKNPLPTKETIEQERKGDATP
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaagcccgacatgactgaaatcgctaattttgacaagacaaagctgaagaag
acggagaccaaagaaaagaaccctctgcccaccaaagagaccattgagcaggagaggaag
ggcgacgccacaccttga

DBGET integrated database retrieval system