KEGG   Takifugu rubripes (torafugu): 101066448Help
Entry
101066448         CDS       T02386                                 

Gene name
aurka
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101066448 (aurka)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101066448 (aurka)
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   101066448 (aurka)
Protein phosphatases and associated proteins [BR:tru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101066448 (aurka)
Chromosome [BR:tru03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101066448 (aurka)
  Spindle formation proteins
   101066448 (aurka)
  Sister chromatid separation proteins
   Aurora kinases
    101066448 (aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
19
AA seq 421 aa AA seqDB search
MDSASKQKLTKDMKSLRPEVKSSGGGPKRIPVSQQSHLAVVTPTPQQRVLGLSNGPQRIQ
RPVSHQKSLTDVCYAVKSTHSNQNVDPQSQKSNPALQSKHVSHQISPKINVPNVAQPTAK
QPEPDKMQKKPAKNDCEKASASKRRWSLENFDIGRPLGKGKFGNVYLARERQSRFILALK
VLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDPSRVYLILEFAPKGELYGEL
QRCGSFPEERSATYIMELADALNYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHTP
SSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTHEETYRRIS
RVEYTYPAHTNISDGAKDLVSRLLKHNPMQRLPVQGVLAHPWVVERSTKKPTTVTNEQPS
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggactcagcttctaagcaaaaattgaccaaggacatgaaatctctgcgacctgaagtc
aagtcaagtggtggagggcccaaacggatccccgtgtcacaacaatcccatctcgctgtg
gttacaccaacaccgcaacagcgtgtgttaggtctgtcgaatggacctcagcgcattcag
cggcctgtcagccatcagaagtcgctgactgatgtttgctatgctgtcaagtccacacat
tctaatcaaaacgttgaccctcaaagtcagaaaagtaatccagcactacagtctaagcat
gtttctcaccaaatttcacccaagataaatgtgcctaatgtggcccaaccaacagccaaa
cagcctgagccagataagatgcaaaaaaaacctgcaaaaaacgactgtgaaaaggcttct
gcatcaaaaagacgttggagcctggaaaattttgacattggccgacccctaggaaagggt
aaatttggcaatgtttatctggctcgggagcggcaaagtaggttcatcttggccctcaag
gtgctgttcaagaaacagctggagaaggctggtgtcgagcaccagctgaggagagaagtg
gagatccagtcacacctcaggcaccccaacatcctccgtctctatggttacttccacgac
ccatctcgtgtgtatctcatccttgagtttgcaccaaaaggtgaactatatggggagctg
cagcgctgtggaagtttccctgaggagagaagtgcaacatatatcatggaactggctgat
gccctcaactactgtcactctaagaaggtgattcacagggacatcaaaccagaaaacctg
ttgctgggggccaatggagagctgaagattgcagattttggctggtctgttcatacacct
tcctccaggaggtctacactctgtggaacgttggactacctgcctccagagatgattgag
ggaaaaacccatgatgagaaggtggacttgtggagtcttggggtcctttgttacgagttc
cttgttgggaaacctccttttgaagcaaaaacacatgaggagacctaccgcaggatctca
agggtggagtatacctaccctgcacacacaaacatcagtgatggagccaaagatttggtt
tccaggttgctgaagcacaaccccatgcagagactgcctgtccagggagtcctagctcac
ccctgggtggttgagcgctccaccaaaaagcccacaaccgtgaccaatgagcagcctagc
aattga

DBGET integrated database retrieval system