KEGG   Takifugu rubripes (torafugu): 101066448Help
Entry
101066448         CDS       T02386                                 

Definition
aurora kinase A-B-like
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101066448
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101066448
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   101066448
Protein phosphatases and associated proteins [BR:tru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101066448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 421 aa AA seqDB search
MDSASKQKLTKDMKSLRPEVKSSGGGPKRIPVSQQSHLAVVTPTPQQRVLGLSNGPQRIQ
RPVSHQKSLTDVCYAVKSTHSNQNVDPQSQKSNPALQSKHVSHQISPKINVPNVAQPTAK
QPEPDKMQKKPAKNDCEKASASKRRWSLENFDIGRPLGKGKFGNVYLARERQSRFILALK
VLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDPSRVYLILEFAPKGELYGEL
QRCGSFPEERSATYIMELADALNYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHTP
SSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTHEETYRRIS
RVEYTYPAHTNISDGAKDLVSRLLKHNPMQRLPVQGVLAHPWVVERSTKKPTTVTNEQPS
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggactcagcttctaagcaaaaattgaccaaggacatgaaatctctgcgacctgaagtc
aagtcaagtggtggagggcccaaacggatccccgtgtcacaacaatcccatctcgctgtg
gttacaccaacaccgcaacagcgtgtgttaggtctgtcgaatggacctcagcgcattcag
cggcctgtcagccatcagaagtcgctgactgatgtttgctatgctgtcaagtccacacat
tctaatcaaaacgttgaccctcaaagtcagaaaagtaatccagcactacagtctaagcat
gtttctcaccaaatttcacccaagataaatgtgcctaatgtggcccaaccaacagccaaa
cagcctgagccagataagatgcaaaaaaaacctgcaaaaaacgactgtgaaaaggcttct
gcatcaaaaagacgttggagcctggaaaattttgacattggccgacccctaggaaagggt
aaatttggcaatgtttatctggctcgggagcggcaaagtaggttcatcttggccctcaag
gtgctgttcaagaaacagctggagaaggctggtgtcgagcaccagctgaggagagaagtg
gagatccagtcacacctcaggcaccccaacatcctccgtctctatggttacttccacgac
ccatctcgtgtgtatctcatccttgagtttgcaccaaaaggtgaactatatggggagctg
cagcgctgtggaagtttccctgaggagagaagtgcaacatatatcatggaactggctgat
gccctcaactactgtcactctaagaaggtgattcacagggacatcaaaccagaaaacctg
ttgctgggggccaatggagagctgaagattgcagattttggctggtctgttcatacacct
tcctccaggaggtctacactctgtggaacgttggactacctgcctccagagatgattgag
ggaaaaacccatgatgagaaggtggacttgtggagtcttggggtcctttgttacgagttc
cttgttgggaaacctccttttgaagcaaaaacacatgaggagacctaccgcaggatctca
agggtggagtatacctaccctgcacacacaaacatcagtgatggagccaaagatttggtt
tccaggttgctgaagcacaaccccatgcagagactgcctgtccagggagtcctagctcac
ccctgggtggttgagcgctccaccaaaaagcccacaaccgtgaccaatgagcagcctagc
aattga

DBGET integrated database retrieval system