KEGG   Takifugu rubripes (torafugu): 101066563Help
Entry
101066563         CDS       T02386                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04012  ErbB signaling pathway
tru04068  FoxO signaling pathway
tru04114  Oocyte meiosis
tru04140  Autophagy - animal
tru04150  mTOR signaling pathway
tru04210  Apoptosis
tru04218  Cellular senescence
tru04261  Adrenergic signaling in cardiomyocytes
tru04270  Vascular smooth muscle contraction
tru04350  TGF-beta signaling pathway
tru04370  VEGF signaling pathway
tru04371  Apelin signaling pathway
tru04510  Focal adhesion
tru04520  Adherens junction
tru04540  Gap junction
tru04620  Toll-like receptor signaling pathway
tru04621  NOD-like receptor signaling pathway
tru04625  C-type lectin receptor signaling pathway
tru04810  Regulation of actin cytoskeleton
tru04910  Insulin signaling pathway
tru04912  GnRH signaling pathway
tru04914  Progesterone-mediated oocyte maturation
tru04916  Melanogenesis
tru04933  AGE-RAGE signaling pathway in diabetic complications
tru05132  Salmonella infection
Module
tru_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101066563
   04012 ErbB signaling pathway
    101066563
   04350 TGF-beta signaling pathway
    101066563
   04370 VEGF signaling pathway
    101066563
   04371 Apelin signaling pathway
    101066563
   04068 FoxO signaling pathway
    101066563
   04150 mTOR signaling pathway
    101066563
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101066563
  Cell growth and death
   04114 Oocyte meiosis
    101066563
   04210 Apoptosis
    101066563
   04218 Cellular senescence
    101066563
  Cellular community - eukaryotes
   04510 Focal adhesion
    101066563
   04520 Adherens junction
    101066563
   04540 Gap junction
    101066563
  Cell motility
   04810 Regulation of actin cytoskeleton
    101066563
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101066563
   04621 NOD-like receptor signaling pathway
    101066563
   04625 C-type lectin receptor signaling pathway
    101066563
  Endocrine system
   04910 Insulin signaling pathway
    101066563
   04912 GnRH signaling pathway
    101066563
   04914 Progesterone-mediated oocyte maturation
    101066563
   04916 Melanogenesis
    101066563
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101066563
   04270 Vascular smooth muscle contraction
    101066563
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101066563
  Infectious diseases
   05132 Salmonella infection
    101066563
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101066563
Protein kinases [BR:tru01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101066563
Chromosome and associated proteins [BR:tru03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101066563
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101066563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase YukC Kdo Choline_kinase
Motif
Other DBs
NCBI-GeneID: 101066563
NCBI-ProteinID: XP_003964518
Position
5
AA seq 388 aa AA seqDB search
MADSSTTADSSKGGDAAPAAGAPGAADGAPAAGVKPGCESVRGQMFDVGPRYTNLSYIGE
GAYGMVCSAMDNTTNQRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDILRAQ
HIDSMRDVYIVQTLMETDLYKLLKTQKLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPS
NLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYSKSIDIWS
VGCILAEMLSNRPIFPGKHYLDQLNHILNVLGSPSQEDLNCIINTKARNYLQSLPLKNRI
PWERLYNKSDSKALDLLDRMLTFNPIKRITVEEALAHPYLEQYYDPTDEPVAEEPFNFSM
EVDDLPKEKLKELIYEETARFQDAYQVS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcggattcgagcaccactgcggactcgagcaaaggcggcgatgctgcgcctgctgct
ggggcgcctggtgccgctgatggagcgcccgcagcgggagtcaagcccgggtgcgagtcc
gtgaggggccaaatgtttgacgtgggcccccgctacacaaacctgtcttatatcggagag
ggcgcatacggaatggtttgttcggccatggataacacgacgaaccagcgcgtcgccatc
aagaagatcagcccgttcgagcaccagacgtactgccagcgtacgctgcgggaaatcaag
atcctgctgcgcttccgccacgagaacatcatcggcatcaacgacattctgagggcgcag
cacatcgacagcatgagggatgtctacatcgtgcagactctgatggagacggacctttac
aagctgctgaagacccagaagctgagcaacgaccacgtctgctacttcctctaccagatc
ctgcgaggcctgaagtacatccactcagccaacgtgttgcaccgcgacctgaagccctca
aacctgctcatcaacaccacctgtgacctcaagatctgtgacttcggcctggcccgtatc
gctgaccctgagcacgaccacacaggttttctgaccgagtacgtggccacgcgttggtac
agggctccggaaatcatgctcaactccaagggctattctaagtctattgatatctggtcg
gtcggctgcatcctggcagagatgctgtccaacaggcccatttttcctggaaaacactac
ttggatcaactcaaccacatactgaatgttcttggcagtccgtctcaagaggacctgaac
tgtattatcaacacgaaggccaggaactacctgcagtctctgcccctgaaaaacaggatc
ccctgggaaaggctctacaacaagtcagattcaaaagctctcgacctgctggaccgcatg
ttgacctttaatcccatcaagcgcatcactgtggaggaggctctggctcacccttacctg
gagcagtactacgaccccacagatgagccggtagcagaggagcccttcaatttctccatg
gaagtggacgaccttcccaaggagaagctgaaggaactcatctacgaggagacggctcgt
ttccaggacgcctaccaagtctcctga

DBGET integrated database retrieval system