KEGG   Takifugu rubripes (torafugu): 101066574Help
Entry
101066574         CDS       T02386                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tru00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 619 aa AA seqDB search
MLTSILVFFSSLFLLPLFIPDCSCQTETDLYVQTLAGRVRGVHLPVSDRSYVTAFLGIPF
AEPPVGKRRFRHPEPKRQWSGLYEANAYPNACYQVVDTSFPGFQGSEMWNPNREMSEDCL
YLNVWVPSSPRSHNLTVMVWIYGGGFYSGSSSLDVYDGRYLAHSESIIVVSVNYRIGAFG
FLALHGSAEAPGNAGLLDQRLGLQWVQDNIHFFGGNPKQVTIFGESAGAASVGFHLLSPG
SRPTFTRAILQSGVPNSPWASVTPAEARRRAMMLANLVGCNVVNDTELVDCLRSKRPDEL
LNQEFKVLPWASIFRFPFVPVVDGDVLPDSPQAMISSGSFKDTQLLLGFNQDEGTYFLLY
GAPGFSKDNESLISREDFLEGVKVSVPHANDIGLEAVVLQYTDWLDENNGKKNRDALDDI
VGDHNVICPLAYFARSYAQHLGASSSMLNSGVNSQGGVYVYLFDHRASNIAWPEWMGVIH
GYEIEFVFGLPLEKRLNYTQEEEKLSRRMMKYWANFARTGNPNVNHEGQGDSKKRWPLFT
LSEQKHVVLNTESLKVHRGLRNQMCAFWDRFLPRLLNITDNIDEAERQWKVEFHRWSSYM
MHWKSQFDHYSKQERCTDL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgctgacctccatcctcgtctttttctcttcactcttcctcctgcccctctttatcccc
gactgctcctgccagaccgagacagacctctatgttcagacactcgcaggccgtgtccgt
ggtgttcatctgccagtgtctgaccgcagctatgttaccgcttttctgggcatccctttt
gctgaaccaccagtagggaagcgccgattccgtcatcctgaaccaaagcgtcagtggtcg
ggactgtatgaggccaacgcctaccccaacgcctgctaccaggtggttgatacttccttt
cccggcttccagggcagtgagatgtggaaccctaacagggaaatgagtgaagactgcctg
tacctcaatgtgtgggtgccctcgtcaccaagatctcacaatctcactgtcatggtgtgg
atctacggcggagggttttacagcgggtcttcgtcgctggacgtatacgatggccgttac
ctcgctcatagcgagtccatcattgtggtttctgtgaactaccgcattggtgctttcggg
ttcctcgctttacacggctccgctgaggctccgggaaatgcgggtctgctggaccagcgg
ctgggcctccagtgggtacaggacaatattcacttcttcggcgggaatcccaaacaggtg
actatatttggggaaagtgccggtgctgcttcagtaggattccacctcctatctccaggt
agccggcccaccttcaccagggccattctccagagcggggtccccaactctccctgggca
tcggtcacgccagccgaagcgcggaggcgggcaatgatgctggccaaccttgtaggctgt
aacgtagtaaatgacactgagcttgtggactgtctgcgcagtaaaagaccagacgagctc
ctcaaccaagagttcaaggtcctgccatgggcatccatcttcaggtttccattcgtcccc
gttgtggatggcgatgttctgccggacagtcctcaggctatgataagctcgggtagcttt
aaagacactcagctcttgctcgggttcaatcaggatgaaggcacctacttcctgctgtat
ggagctccgggctttagcaaggacaacgaaagtctcatctctagagaagacttcctggaa
ggtgttaaggtgagcgtacctcatgccaacgatattggcctggaggctgtggtgttacag
tatactgactggttggatgagaataatgggaagaagaaccgtgatgctttggacgacatc
gtgggtgaccataacgttatatgcccactggcctactttgctcgttcctatgcccaacac
ctgggagccagctccagcatgctgaacagtggagtcaattcacagggaggtgtgtacgtc
tacctctttgaccaccgagcgtcaaacatagcgtggccagagtggatgggcgtcatccat
ggctatgagatcgaatttgtcttcggtctgccattggagaagagactgaattacacccaa
gaggaggagaaactgagccgacgcatgatgaaatattgggctaacttcgcacgaactggt
aaccccaacgtcaaccacgaagggcagggtgacagcaaaaaacgctggccactcttcacc
ctcagtgagcagaaacacgtcgtactcaataccgaaagtctgaaggtccacagaggtctg
aggaaccagatgtgcgctttctgggatcgctttctgccacgtctcctcaacatcacagac
aacatcgatgaggcagagcgccagtggaaggtggagttccaccgctggtcctcctacatg
atgcactggaagagccagttcgaccactacagcaaacaggagcgctgcaccgacctctga

DBGET integrated database retrieval system