KEGG   Takifugu rubripes (torafugu): 101066601Help
Entry
101066601         CDS       T02386                                 

Definition
eukaryotic translation initiation factor 3 subunit B-like
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tru03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 680 aa AA seqDB search
MQETVDMMDDPEYEEEEPSFSDPEDYVDDIEDEELLEDVLKEKPQEADGIDSVVVVDNVP
QVGPERLEKLKNVIHKIFSKFGKITTEFYPEADGATKGYIFLEYAAPTQALEAVKNADGY
KLDKQHTFRVNLFTDFDKYMNISDEWETPEKQPFKDFGNLRHWIEDPDCRDQYSVIYEAG
ERTAIFNNDSKDPITVEERARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSH
QGVSLIDFSPCERYVVTFSPLMDTKEDPQAIIIWDILTGQKKRGFHCESSAHWPIFKWSH
DGKFFARMTTDTLSIYETPSMGLLDKKSLKITGIKDFSWSPGDNIIAFWVPEDKDIPARV
TLMQLPSRQEIRVRNLFNVVDCKLHWQRNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQ
VPVDVVEMKESIIAFAWEPNDSKFAVLHGESPRISVSFYHVKNNGKIELLKMFDKQQANS
IFWSPQGQFLVLAGLRSMNGALAFVDTSDCTLMNIAEHYMASDVEWDPTGRYVVTSVSWW
SHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPSLLTADQIKMIKKDLKKYSKIFEQ
KDRLSQSKASKELVDKRRAMMEDYRRYREEASKVYQEQKSLRLALRGAVDTDEPDSNVDD
WEEETIEFFINEEVIPFGDL
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaacggtggatatgatggacgaccctgagtatgaagaggaggagccctctttc
agcgaccccgaggactacgtagatgacatcgaagatgaggagctcctggaggacgtcctg
aaggagaagcctcaggaggcggatggcattgactctgtggtggtggtagataacgtccct
caggtgggccctgagagattggaaaaactcaaaaatgtcatccataagatcttctccaag
tttggcaaaatcacaacagaattttacccagaggctgatggcgcgacaaaggggtacatc
tttctagagtacgccgctcccacccaggctctggaagcagttaagaatgcagatggttac
aaacttgacaaacagcacacattcagggtcaacctcttcactgactttgacaagtacatg
aacatcagtgatgagtgggaaactccggagaagcagccgttcaaagattttggaaatctg
cgccactggattgaggatccagactgtcgtgaccaatacagcgtgatctatgaagctggt
gagaggacggcaatttttaataatgactccaaggacccgatcacagttgaagaaagagcc
cgctggacggagacgtatgtgcgttggtctcctaaaggcacctacctggctaccttccac
cagcgtggcattgccttgtggggtggcgagaaattcaaacagattcagaggtttagtcat
cagggtgtctccctcatcgacttctcaccatgtgagaggtatgtggtgaccttcagtcca
ctgatggacactaaggaggacccacaggccatcatcatctgggacatcctgaccggacag
aaaaagagaggcttccactgcgagagctcggcacattggcccattttcaagtggagtcat
gatgggaagttttttgccaggatgaccacagacacgctgagtatctatgagactccatct
atgggattgctggacaagaagagtcttaaaattactgggattaaggacttttcgtggtct
cctggtgacaacatcatagcattctgggtacctgaggacaaggacatcccagccagagtg
actctgatgcagttaccttcccgccaggagattcgcgtccgcaacctcttcaacgtggtg
gactgcaaactgcactggcagagaaatggagattacctgtgtgtgaaagtggacaggact
ccgaaaggaacgcagggcgtcgttaccaactttgagatcttccgaatgagagagaagcag
gtgcccgttgatgtggtggagatgaaagaaagcattatagcatttgcctgggaacccaat
gacagcaaatttgctgttctccacggagagtctcccagaatcagcgtctccttttatcat
gtcaaaaataacggaaagatcgagctcttgaagatgtttgacaagcagcaggccaacagc
atattctggagcccccagggacagttcctggtgctggctggtctcaggagtatgaatgga
gctcttgctttcgtggacacgtcagactgcaccttgatgaacatagcagagcactacatg
gcctctgatgtggagtgggacccaaccggtcgctatgtggtgacctctgtctcctggtgg
agccataaggtggacaacgcatactggctgtggacgtttcagggccgtctccttcagaag
aacaacaaagatcgcttctgtcagctgctctggagaccccgaccgccctccctgctcact
gcagatcaaatcaagatgatcaagaaagatctcaagaagtattccaagatctttgagcag
aaggatcgtctgagccagtccaaggcctccaaggagctggtggacaaacgcagggccatg
atggaggattaccgccgctacagggaggaagcaagcaaggtctaccaggaacagaagagc
ctccggctggcactcagaggagctgtggataccgatgaaccggacagtaatgtagatgac
tgggaggaggagaccattgagttttttatcaacgaagaagtcattccctttggagatctg
tag

DBGET integrated database retrieval system