KEGG   Takifugu rubripes (torafugu): 101066621Help
Entry
101066621         CDS       T02386                                 

Definition
dopamine beta-hydroxylase-like
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101066621
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     101066621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 619 aa AA seqDB search
MRIFNRDLRLQDVTLLYFTALAALMVILVASYQAPMHAVDVSKLVPSGPLPPLPMPFRVP
LDPRGELYLAWNISYANQEIYMELRVADLKQGVLLGMSDQGELTNADLVVLWNTGTRSYF
GDAWSDAEGRVSLDSQQDYELIQAKQKPDGYYLLFKRPFSTCDPKDYLIEEGTVHIIYGF
LDGPLSTLGQLNLSRIHTGVQRVLMLRPDTPPPALPPDVQTLEVRAPNVVIPSQETTYWC
FIQMLPDNMPKNHIIMYESVITPGNEAIVHHIEVFQCSPDVQTVPQYSGSCDDKMKPSKL
NFCRHVLAAWAMGAEGFYYPSDAGLPMGGPGSSRYLRLEVHYHNPLLISGRQDSSGIRLH
YTASLRRYDAAIMELGLVYTPIMAAPPKQRAFHLSGYCTSKCTQTALPPGGIYIFASQLH
THLAGRGVRTVLVRGGEEREVVQEDQHFSAHYQPIRVLRKAVHVLPGDVLITKCTYNTED
RSKPTVGGFGIMEEMCVNYVHYYPQTMLELCKTHVDMAHLQKFFSAMNRFHGSDPCVCGE
VGVTEQYSQVRWDPFAVQVLNSLYNTAPISMHCNQSDARAFPGDWDDQPLPLVSSTLDKA
RYPCEAAGPPSGPTPTPHA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcttcaaccgggacctccgtcttcaggacgtcaccctcttgtacttcacagct
ctggctgcactcatggtgatcttggtggcttcgtatcaggcgcccatgcacgccgttgat
gtgtccaaattggtcccctcgggccccctcccacctctccccatgcccttccgtgtgccc
ctcgacccacgtggagaactctacctggcctggaacatcagctacgccaatcaggagatt
tacatggagctgagggtcgctgacctcaagcaaggcgtgctgttggggatgtctgaccag
ggggagctgaccaacgccgacctggtggtgctgtggaacaccggcaccagaagctacttt
ggggacgcgtggagcgacgccgagggccgcgtttcactggacagccaacaagattacgag
ctgatccaagccaagcagaagcctgacggatactacctgctcttcaagagacccttcagt
acctgtgatcccaaagattacctcatcgaggagggaactgtacacatcatttacggattc
ttggatggaccgctttccacgctggggcagctcaacctgtcacgcatccacaccggcgtg
cagagagtcctgatgctgcggcccgacacgcccccgcctgcgctacctccagacgtgcag
acgttggaggtccgggctcccaacgtggtcataccgagccaggagaccacctactggtgc
ttcattcagatgcttcctgacaacatgcccaagaaccacatcatcatgtacgagtcggtg
ataactccgggtaatgaggccatcgtgcatcacatcgaggtgttccagtgttctcctgac
gtccagaccgttcctcagtacagcggctcctgcgatgacaagatgaagccgagcaagctc
aacttctgccgccatgtgctcgctgcgtgggccatgggtgctgagggcttttattatccc
tctgatgcagggctgccgatgggcggacccggctcctccaggtacctgcgcctggaggtc
cattaccacaaccccctcctcatatctggccggcaggactcatcggggatacggctccat
tacacggccagtctgaggcgctacgatgccgccatcatggagctgggcctggtttacact
cccatcatggcggcgcctccgaagcagcgcgcgttccacctgagcggatactgcacctcc
aagtgcacccagaccgctttgcctccaggaggaatctatatatttgcgtcgcagctgcac
acccacctggcgggtcgaggggtgaggacggtgttggtgagggggggggaggagcgtgag
gtggtgcaggaggaccagcacttcagtgcacactatcagccgattcgcgtcctgaggaaa
gctgtgcacgttctacctggcgacgtcctcataaccaagtgtacttataacacagaagat
cgcagcaagcccacagtgggaggatttggaatcatggaggaaatgtgcgtcaactacgtc
cactactaccctcaaaccatgctggagctctgcaagacccacgtggacatggcccacctg
cagaagttcttcagtgccatgaacaggttccatggaagtgacccgtgtgtgtgcggcgag
gtcggggtgacggagcagtattcgcaggtccgctgggacccattcgctgtgcaggtgctc
aactccctctacaacacggcccccatctccatgcactgcaaccagtcggacgcacgcgcc
ttcccgggggactgggacgaccagccgctgcctctggtctcctccaccctggacaaagcg
cgctacccctgtgaggcggccggccccccctctggaccgacccctactccccatgcctga

DBGET integrated database retrieval system