KEGG   Takifugu rubripes (torafugu): 101066719Help
Entry
101066719         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase CYLD-like
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    101066719
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101066719
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C67
   101066719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 956 aa AA seqDB search
MSSALWSQEKPSGGFRDDWRFYMVIKECTVEKPSQKTLRIPRGSLGQACQERNSLGRTLT
PCKGKKSLRILDQTNVVLSLDERDVLELDENLAELLFPITNCEERYALLCNKSRLDRVRD
IDCGSKVRVQLRSGDEPLPGVVRFKGSLLPDRALAGIWFGVELLEEGRGQGFTEGSYQGR
QLFRCEDECGVFVALDKLELWEDDDDEVLGELEVDHLSLVEEDQDFRPLEINSRVIVQTR
EGPERGTVIFCDLLPGNESLGYYVGVDMDNPIGDWNGVFDGKLLCNFASLEHTRLVPICD
VMPEYSMQDQRLQKHSFAQRGNNTEKSSSGQSKPKSKGLGHQSGSRSKSEFYYTLNGSSV
DPPVQSKSKSTWYIDEVGEDPAKSLTETPPDFNQSPPPSRAPPPASLPSDNKFHSLPFSL
NRKPGPIDSMSHGPLSLSVQSVMGEQPEPTSPAAPPSPRPPTPPRGQLGLEVGSLVEVKE
NPPLCGVIRWVGLPPGLLEPLAGLELEDECPGCTDGTFKGTRYFTCPPKKALFVKLKCCR
PDSRFPSLHHSSNPIERCNSIAFGGYLSEVVHENTPPRTENDGLDVMVGKKKGIQGHYNS
CYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYRETQELLRTEIVNPLRIHGYVCATKVM
KLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPLLKLRSAGQKVQDCYFYQIFMD
KKDKVGVPTIQQLLEWSFINSDLKFAEAPSCLIIQMPRFGKDFKMFNKIFPSLELDITDL
LEDTPRECRICGGLALYECRDCYEDGDITAGKIKQFCEKCNIQVHLHPRRKSHRHSKLCV
PKELQDGTGRQSSFPRQRMELFAVLCIETSHYVAFVKYGSADSSWLFFDSMADRDGGQNG
FNIPQVSPCPEVEAYLKMTPEELHTLDPKSIQGQARRLLCDAYMCMYQSPTMSLYK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgccctgtggagccaggagaagcccagtggtggcttcagggacgactggcgc
ttttacatggtcataaaggagtgtacggttgagaagccttcccagaaaaccctgaggatc
ccgcgtggtagtctcggtcaggcttgccaggagcgcaacagcctaggacgaacgctaacc
ccgtgtaagggaaagaaaagcctccgcattctggaccagaccaatgtggtgctgagcctg
gatgagcgggacgtgctggagctggatgagaatcttgcagagctgctgtttcccattacc
aactgtgaggagcgatatgctctgctctgcaacaagtcaagattagaccgtgtgcgggat
attgactgtggatcgaaggtgcgtgtccagctgcgctccggggatgagcctcttcctggt
gtggtccgcttcaagggctcactgctcccagacagagctctggctggaatctggtttgga
gtagagttgctggaagagggcagaggccaaggcttcacggagggctcctatcagggtcgg
caactgttccgctgcgaggatgagtgtggagtgtttgtggcactggataaactagaactt
tgggaggatgatgatgatgaagtcttgggtgagctggaggtcgatcatctcagtctggtg
gaagaggaccaggactttcgtcctctggagatcaactctcgggtcatcgtccaaaccagg
gaaggaccagaaaggggcaccgtcattttctgtgaccttttgccaggcaatgagagcctc
ggctactatgtgggtgttgacatggacaatcctataggggactggaatggtgtgtttgac
gggaagctgctttgtaattttgccagtttggaacacactcgacttgtcccaatctgtgac
gtaatgccagaatattccatgcaggaccaaaggctgcaaaagcacagttttgcccaaaga
ggcaacaacaccgagaagtcgtcctctggccaaagcaaaccaaagagcaaaggattaggt
caccagagcggcagtagaagcaagtctgaattttactatactttaaatggcagctctgtt
gatcccccagtccagtccaaatccaaaagcacatggtacattgatgaagttggggaggat
cctgccaagtccctcactgagacaccccccgactttaaccagtcccccccaccctccaga
gccccgcctcctgcctcattgcccagtgacaacaagtttcactctttgcccttcagcctg
aaccggaagcccgggcccattgacagcatgagtcatgggccgctgtccctgtctgtacag
tcggtgatgggagagcagcctgagcccacatcacctgctgcacctccctcacctcggcct
ccaacgcctcccagaggacagctgggactagaggtgggctcactggtggaggtgaaggag
aatccaccgctctgcggtgtcatccgctgggtcgggctgcctccgggcctgctggagcct
ctggctgggctggagctggaggatgagtgccccggatgcaccgacgggacattcaaagga
actcggtacttcacctgtccacccaaaaaagctctgtttgtgaagctcaagtgctgccgt
cctgactcccggttcccgtcgctgcatcactcctctaaccccatagagcgatgcaactct
attgcatttggaggctacctgagtgaagtggtgcacgagaacacacctcctcgcacagag
aacgatggtctggacgtcatggtgggaaaaaagaaaggcatccagggccactacaactcc
tgctacctagattctacccttttctgcttgttctcattcagctctgtgcttgacacggtt
ctgctgagaccacgctcaaagactgatgtggaatattacagagagacccaagagctgctg
cgcactgagatagtcaaccctctgcgcatacatgggtatgtttgtgccactaaagtgatg
aagctcaggaggatcctggagaaagttgaagctgcctctggattcacctctgaagagaaa
gacccagaagagttcctcaatatacttttccatcacatattgagggtggaccctttgctc
aagttaaggtcagcaggacagaaggttcaggactgttacttttaccaaattttcatggac
aaaaaggacaaggttggagttcccaccatacagcagctcctggagtggtctttcatcaac
agtgacctaaagtttgcagaggctccctcctgcctgatcattcagatgccccgctttggc
aaggacttcaaaatgttcaacaagatttttccatccctggagttggacatcacagatctt
cttgaagacactccaagagaatgccgaatctgcggaggcctggctctctacgagtgtaga
gactgttatgaggacggggacatcaccgctggcaagattaaacaattctgtgaaaagtgc
aatatacaggttcacctccatccgaggaggaaatcccatcggcacagtaagctgtgtgtc
cccaaggagttgcaagatggtacggggcggcagagcagctttccccgccagaggatggag
ctgtttgcagtgctgtgcattgaaacaagtcactacgtggcctttgtcaagtacggcagc
gcggattcttcctggctcttcttcgacagcatggctgacagagacggtgggcagaatggc
ttcaacatcccgcaggtgtccccctgtccagaggtggaggcctacctaaaaatgacacca
gaggagctgcacactctggatcctaaaagcatccagggtcaggcacgacgcctgctgtgt
gacgcctacatgtgcatgtaccagagcccgaccatgagcctgtacaagtaa

DBGET integrated database retrieval system