KEGG   Takifugu rubripes (torafugu): 101066856Help
Entry
101066856         CDS       T02386                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 2-like
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101066856
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101066856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 250 aa AA seqDB search
MECQDSLVSFLSWALMFGGLVYLLQQVRQIPAQYGRYSPAEGPTFPAKLAWFLQEVPAFL
VPLVLLLQSPETGARASVSLFAFLLHYFHRSFIFASLTQGRPVPVEIVLFAALFCCLNGF
LQGHHLLHCTSDEDTWPPRAHKAVGFLLFLVGMTINIHSDHILRNLRKPGELVYRIPRGG
IFELVSGANFLGEIVEWCGYTVVAWSFPAFAFTFFTVCSLGPRAYHHHRDYVQRFEDYPH
SRAAIIPFLL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtcaggattcgctcgtgtctttcctcagctgggctctgatgtttgggggtctg
gtctacctgttgcaacaagtgaggcagatccccgcccagtacggccgttacagcccggca
gaaggacctacttttccggccaaactggcctggttcctgcaggaggtccccgccttcctt
gtgccgctggtactgctgctgcaaagcccagagaccggggccagggcgagtgtatccctg
tttgccttcctgctgcactatttccaccggagcttcatctttgcctccttgacccaagga
cgacccgtcccagtggaaattgtactcttcgctgctctcttctgttgcctcaatgggttt
ctgcaagggcaccacctgctgcactgcacatctgatgaggacacctggcctccccgggcc
cacaaagccgtaggttttcttctcttcctggttggaatgaccatcaacattcacagcgac
cacatcctgcgtaacctgaggaagccaggagagttggtgtacaggattcctcgtggtgga
atatttgagttggtgtctggagcgaatttcctgggtgagattgtggagtggtgcggttat
accgtggtcgcttggtcctttcctgcatttgccttcaccttcttcaccgtgtgctccctt
ggacccagagcctaccaccatcacagggactacgtacagaggtttgaagactaccctcat
tccagagctgcaatcattcccttccttctgtga

DBGET integrated database retrieval system