KEGG   Takifugu rubripes (torafugu): 101066998Help
Entry
101066998         CDS       T02386                                 

Definition
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial-like
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     101066998
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   101066998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 405 aa AA seqDB search
MRILRFLRSSISAGKDIDYYSKFSPSPLSMKQFLDFGSENACEKTSFAFLRQELPVRLAN
IMKEINLLPDNLLRTPSVRLVQSWYMQSFQDILEFRDRNAEDEKVTHDFTNAVIKIRNRH
NDVIPTMAQGVVEYKETYGTDPVVSQNVQYFLDRFYMSRISIRMLLNQHTLIFGGKVNPA
HPKQIGGIDPHCRVSDVVRDAFENARNLCDRYYMNSPELVLEEFNVEEKEKPITVVYVPS
HLYHMVFELFKNAMRATMELYGDAMEYPAVHAQVALGNEDLTVKVSDRGGGVPLRKIDRL
FTYTYSTAPRPSLDGSRAAPLAGYGYGLPISRLYARYFQGDLKLYSLEGHGTDAVIYIRA
LSTESIERLPVYNKSAWKHYKTIHEADDWCVPSKEPKDMTTFRSF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaggattttaaggtttctccggagcagcatttctgcaggaaaggacatagactattat
tccaaattctccccatcacctctttcaatgaagcagtttctggatttcggttcagaaaat
gcatgtgagaaaacctccttcgccttcctcagacaggagttgcccgtgaggttggccaac
atcatgaaagagatcaatctgttgccggacaacttgctcagaaccccatctgtccgcttg
gttcagagctggtacatgcaaagttttcaggacatcctggagttcagagacagaaatgca
gaagatgagaaagtcacacatgatttcacaaatgcggtcataaagatccgaaaccggcac
aacgatgtgattcccaccatggctcagggagtggtggagtacaaagagacatacggcaca
gacccggtcgtcagccagaacgttcagtacttcctggatcgtttctatatgagcaggata
tccatcaggatgttgctcaaccagcacactctcatctttggtgggaaggtgaacccagcg
catcccaagcagatcggcggtatcgacccgcactgtcgcgtcagcgatgtggtcagagat
gcctttgaaaatgctcgaaacctctgcgaccgctactacatgaactcccccgaattggtg
ctggaggaattcaacgttgaagaaaaggaaaagcccatcacagtggtctacgtgccgtcc
catttgtaccacatggtgtttgaactcttcaagaatgccatgcgagccaccatggagctc
tacggcgacgccatggagtatcctgccgtccacgcgcaggtggctctggggaatgaggac
ctgactgtgaaggtgagcgatcgtggaggaggggtgccgctgcggaagatcgaccggttg
tttacctacacgtactccacagctccccggcccagcctggatgggtcccgcgctgctcct
ctggctggctacggatacggcctccccatctctcgactgtacgcgcgctactttcagggc
gacttgaagctctactccctggagggtcatggaaccgatgcagtgatctacatccgggca
ctgtccaccgagtcaatcgagaggcttccagtctacaacaaatccgcctggaaacattac
aagactatccatgaggccgatgactggtgcgttcccagtaaggagcccaaagacatgaca
acatttcgcagtttctag

DBGET integrated database retrieval system