KEGG   Takifugu rubripes (torafugu): 101067014Help
Entry
101067014         CDS       T02386                                 

Definition
beta-hexosaminidase subunit beta-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101067014
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    101067014
   00603 Glycosphingolipid biosynthesis - globo series
    101067014
   00604 Glycosphingolipid biosynthesis - ganglio series
    101067014
   00511 Other glycan degradation
    101067014
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101067014
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     101067014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 551 aa AA seqDB search
MNVSTNILALLFLALGSCQGLRRHHVDGIVEEEIEFVAQPSKFGSLWPLPQKVQISQVSF
KLTGFSFNIVDAKQSSAGPSCALLQDAYRRYYEYMFGNAKRSGKNKSRRTGPTDLTELQV
WITSADSDCDAYPSVKSDESYELTVDQPFAVLKAPKVWGALHGLETFSQLIYEDDYGAKS
INATSISDFPRFPHRGILLDTSRHFLPVKVILANLETMAMNKINVFHWHIVDEPSFPYMS
KTFPQLSQQGAFHPYTHVYTPADVKMVIEFARLRGIRVVAEFDTPGHTQSWGKGQKDLLT
PCYSGSKLSGSFGPVNPILNTTYTFMTQFFKEVSTVFPDGYVHLGGDEVDFNCWKSNPNI
TKFMDQQGFGRDYSKLESFYIQRLLDIVATTNKGYMVWQEVFDNGVKLKPDTVVHVWIGG
RYNDEMSKVTAAGYPTLLSAPWYLDYISYAQDWQNYYKVEPLSFNGTDAQKKLVIGGEAC
LWGEYVDSTNVTPRLWPRASAVAERLWSSKDVRDVNDAYNRLSGHRCRMVERGIPAEPLF
TSYCPREYRGV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgtccacgaacatcctcgcgctgctctttctcgccctgggctcgtgccagggg
ctgcggcgacaccacgtcgatggaatcgtagaagaagagatcgagtttgtggcgcagccg
tccaaatttggctccctgtggcctctgccgcagaaagtgcagatctctcaggtttcgttc
aagttgacgggcttcagcttcaatatcgttgacgccaaacagtcctcggcggggccgagc
tgcgccctcctgcaggacgcttacagaagatattatgaatacatgttcggcaacgctaaa
aggtccggtaaaaacaaaagcaggcgaactggtcccactgatctgacagagctgcaggtg
tggatcacctcagcggactccgactgtgacgcttaccccagtgtgaagtctgacgagtca
tatgagctgacagtggaccaaccctttgctgtgctgaaagcacctaaggtgtggggagcc
ctccacggcttggaaactttcagccagttgatttatgaggacgactatggcgctaaaagc
atcaatgcaacgtccatcagcgacttccccaggttccctcaccggggcatcctgctggac
acctctcggcatttcctgccggtcaaagtaatcctggccaacctggaaaccatggcaatg
aataaaataaacgtcttccactggcacattgtggatgaaccgtcctttccttacatgagc
aaaacattcccacagctgagccaacagggagcattccacccgtacacacatgtgtacacg
cctgctgatgtgaagatggtgattgaatttgcccgtctgaggggtattcgtgttgtggcg
gagtttgacacgcccggacacactcagtcttggggcaaaggccagaaagatttgctcaca
ccgtgttactccggatcaaagctttctggctcctttggaccggtgaaccccatcctgaac
accacctataccttcatgacccagttctttaaagaagtcagcacggtgttccccgatggc
tacgttcacctggggggcgatgaggtggacttcaactgctggaagtccaacccaaatatt
acaaaattcatggaccaacagggttttggtcgagactacagcaagctggaatctttctat
attcaaaggctcttggatattgtggccaccactaacaagggttacatggtgtggcaggaa
gtctttgacaatggtgtcaagctaaagccagacacggtagtacatgtgtggatcggcggc
cggtataatgacgagatgagcaaggtgacagcagcaggctatcccaccctcctctctgcc
ccgtggtacctagattacattagctacgcacaggactggcagaactactacaaggttgag
ccgctcagcttcaacggcactgatgcacaaaagaagcttgtcattggtggagaggcctgc
ctctggggggagtatgtggattccaccaacgtgacaccaaggctctggcctcgtgccagc
gctgtggccgagcgattgtggagttccaaggatgtgagggacgtcaacgacgcctacaac
agactgtccgggcatcgctgtcgcatggtggagcgagggatcccggcggaaccgctgttc
accagctattgcccccgcgagtacaggggggtttga

DBGET integrated database retrieval system