KEGG   Takifugu rubripes (torafugu): 101067014Help
Entry
101067014         CDS       T02386                                 

Definition
beta-hexosaminidase subunit beta-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tru00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:tru00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:tru00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:tru00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tru00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tru04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 551 aa AA seqDB search
MNVSTNILALLFLALGSCQGLRRHHVDGIVEEEIEFVAQPSKFGSLWPLPQKVQISQVSF
KLTGFSFNIVDAKQSSAGPSCALLQDAYRRYYEYMFGNAKRSGKNKSRRTGPTDLTELQV
WITSADSDCDAYPSVKSDESYELTVDQPFAVLKAPKVWGALHGLETFSQLIYEDDYGAKS
INATSISDFPRFPHRGILLDTSRHFLPVKVILANLETMAMNKINVFHWHIVDEPSFPYMS
KTFPQLSQQGAFHPYTHVYTPADVKMVIEFARLRGIRVVAEFDTPGHTQSWGKGQKDLLT
PCYSGSKLSGSFGPVNPILNTTYTFMTQFFKEVSTVFPDGYVHLGGDEVDFNCWKSNPNI
TKFMDQQGFGRDYSKLESFYIQRLLDIVATTNKGYMVWQEVFDNGVKLKPDTVVHVWIGG
RYNDEMSKVTAAGYPTLLSAPWYLDYISYAQDWQNYYKVEPLSFNGTDAQKKLVIGGEAC
LWGEYVDSTNVTPRLWPRASAVAERLWSSKDVRDVNDAYNRLSGHRCRMVERGIPAEPLF
TSYCPREYRGV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgtccacgaacatcctcgcgctgctctttctcgccctgggctcgtgccagggg
ctgcggcgacaccacgtcgatggaatcgtagaagaagagatcgagtttgtggcgcagccg
tccaaatttggctccctgtggcctctgccgcagaaagtgcagatctctcaggtttcgttc
aagttgacgggcttcagcttcaatatcgttgacgccaaacagtcctcggcggggccgagc
tgcgccctcctgcaggacgcttacagaagatattatgaatacatgttcggcaacgctaaa
aggtccggtaaaaacaaaagcaggcgaactggtcccactgatctgacagagctgcaggtg
tggatcacctcagcggactccgactgtgacgcttaccccagtgtgaagtctgacgagtca
tatgagctgacagtggaccaaccctttgctgtgctgaaagcacctaaggtgtggggagcc
ctccacggcttggaaactttcagccagttgatttatgaggacgactatggcgctaaaagc
atcaatgcaacgtccatcagcgacttccccaggttccctcaccggggcatcctgctggac
acctctcggcatttcctgccggtcaaagtaatcctggccaacctggaaaccatggcaatg
aataaaataaacgtcttccactggcacattgtggatgaaccgtcctttccttacatgagc
aaaacattcccacagctgagccaacagggagcattccacccgtacacacatgtgtacacg
cctgctgatgtgaagatggtgattgaatttgcccgtctgaggggtattcgtgttgtggcg
gagtttgacacgcccggacacactcagtcttggggcaaaggccagaaagatttgctcaca
ccgtgttactccggatcaaagctttctggctcctttggaccggtgaaccccatcctgaac
accacctataccttcatgacccagttctttaaagaagtcagcacggtgttccccgatggc
tacgttcacctggggggcgatgaggtggacttcaactgctggaagtccaacccaaatatt
acaaaattcatggaccaacagggttttggtcgagactacagcaagctggaatctttctat
attcaaaggctcttggatattgtggccaccactaacaagggttacatggtgtggcaggaa
gtctttgacaatggtgtcaagctaaagccagacacggtagtacatgtgtggatcggcggc
cggtataatgacgagatgagcaaggtgacagcagcaggctatcccaccctcctctctgcc
ccgtggtacctagattacattagctacgcacaggactggcagaactactacaaggttgag
ccgctcagcttcaacggcactgatgcacaaaagaagcttgtcattggtggagaggcctgc
ctctggggggagtatgtggattccaccaacgtgacaccaaggctctggcctcgtgccagc
gctgtggccgagcgattgtggagttccaaggatgtgagggacgtcaacgacgcctacaac
agactgtccgggcatcgctgtcgcatggtggagcgagggatcccggcggaaccgctgttc
accagctattgcccccgcgagtacaggggggtttga

DBGET integrated database retrieval system