KEGG   Takifugu rubripes (torafugu): 101067130Help
Entry
101067130         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 13-like
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 864 aa AA seqDB search
MATDLGELLVPYMPTIRVPRTGDRVFKSECAFSFDSPESEGGLYVCMNTFLGFGREHVER
HYRKTGQSVYMHLKRHVKEKATGAAGGAIPRRRNGKVFLDLELNRDFNGDDYEYEDEAKL
VIFPDHFEIPLPNIEELPALVTIACDAVLNASSAYKKQEPESWDEEIQVSRHARSLRQLD
NGVRIPPSGWKCQKCEMRENLWLNLTDGAVLCGKWFFDGSGGNGHALEHYRETSYPLAVK
MDTITPDGADIYSFEEEEAVLDPHISDHLSHFGIDMLQMQKRTENGHHRENNSRPRVSEW
EVIQESGMKLKAVFGSGYTGIKNLGNTCYLSTVMQVLFSIPDFQRMYVGNLQRIFDYSPL
DPSQDFATQMAKLGHGLLSGQYSKPPMKSELIEQVMNEEHKMLNWHQQKGVSPRMLKALV
SRGHPEFSSNRQQDAHEFLLHLINLVERNSAGSENPSDVFRFLVEERVQCCQSRQVRYSQ
RVDYCIQLPAPLEAAINREELLTYEAKKKEAEENMQPPPEPVRARIPFTACLQAFTEPEN
VPDFWSSALQAKSAGVKTSRFASFPEYLILQIKKFTFGVDWVPKKLDLAIDVPDFLDLNR
LRATGLQASEEELPDLMPPIVLPEDTRDNSMSSIDSPEIDEAAVMQLAEMGFPLEACRKA
VYYTGNMGPEMAFNWIIAHMEEPDFAEPLTLPSLMDSAPSTSDSVMGATPLDPNPPPEES
ISILTSMGFPRTHSINALKAMNNNLERALDWIFTHPEPEESDALSDMADTEPNDNAFSNA
NSHSDATLSPDRDTTGPRIKDGPGRYELFAFISHMGESTMSGHYVCHIKKEGRWVIYNDH
KVCLSERPPKDLGYIYFYHRLSSS
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagacctcggagagctgctggtcccctacatgcccaccatcagggttcccagg
accggagaccgggtgttcaagagcgagtgcgcgttttccttcgactcccccgagtcggag
ggaggtctgtatgtgtgtatgaacacgttcctggggtttggacgagaacacgtggagaga
cactatcgcaaaacaggacagagtgtgtacatgcacctcaaaaggcacgtcaaagagaaa
gccacaggagctgccggcggcgccatccccagacgaaggaatggaaaagtatttctagat
ttagagctcaaccgtgattttaacggagacgactatgagtatgaggacgaggccaagctg
gtcattttcccagatcacttcgagatccccttaccaaatattgaggagttgcccgctctg
gtgaccatcgcctgtgacgcagtgctgaatgcatcctcggcttacaagaagcaagagcct
gaatcgtgggacgaggagatccaggtgtccagacacgccaggagcctcaggcagttggat
aacggagtcagaatcccaccaagcggctggaagtgtcagaagtgtgagatgagggagaac
ctgtggctgaacctgacagacggagcagtgctctgtgggaagtggttcttcgatggcagc
gggggcaacggtcatgccctggagcattacagagagaccagctatcctctggctgtcaag
atggacacaatcacaccagacggagcagatatctattcttttgaggaggaggaggctgtg
ttggacccccacatatccgatcacttatcccactttggaatagacatgctgcagatgcag
aaaagaacagagaatggacatcacagagaaaataactccaggccacgggtcagcgagtgg
gaagtgatccaggagtcaggaatgaagctgaaggccgtgtttggttctgggtacacgggc
atcaaaaatctgggcaacacttgctacctcagcacagtgatgcaggtcctctttagcatc
ccagacttccagaggatgtatgtggggaatcttcagaggatatttgactattcacccctt
gacccgagccaagactttgcaacacagatggctaagctgggacacggactgctctcaggc
cagtactccaaaccgcctatgaaatctgagctgattgaacaggtgatgaatgaagaacac
aagatgttaaactggcaccagcagaaaggcgtatctccacgcatgctgaaggcgctggtc
agcagggggcaccccgagttctcctccaacagacaacaggacgctcacgagttcttgctg
cacctcataaacctggttgagaggaacagcgctggctctgagaatccaagcgatgtcttc
cgcttcctggttgaggagcgagttcagtgctgtcagagtcgacaggttcgatacagtcag
cgggtcgactactgcatccagctgccagcccctttggaggcggccattaacagagaggag
ctgctgacttacgaggctaagaagaaagaggcagaggagaacatgcagcctcctcctgag
ccagtgagagcgcgcatcccctttactgcatgtctacaggccttcaccgaaccagagaat
gtgccagacttctggagctctgcgctgcaagccaagtcagctggagtcaaaacctcccgc
tttgcctccttcccagagtatttgatattacagatcaaaaagttcacatttggagttgac
tgggtacccaaaaaactagatttggccatagatgttccagattttctggatctgaatcga
ttgcgggccacggggctgcaggccagtgaagaggagctacctgacctcatgcctcccatc
gtgctgcctgaagacaccagagataactccatgagctccatcgactctccagaaatagac
gaggcggcagtaatgcagctggcagaaatgggctttccactggaggcctgcaggaaggcg
gtctactacacaggcaacatggggcctgaaatggcctttaactggatcatagctcacatg
gaggagccggactttgccgaacctctcactctgccctccctgatggattccgccccctcc
accagcgacagcgtcatgggggccaccccgctggatcccaacccgcctcccgaggagagc
atctccatcctcacgtcgatggggttcccccgcactcacagcatcaacgctctgaaagcc
atgaacaataacctggagcgagccctggactggatcttcacccatccagagccggaggag
agtgatgccctttcagacatggctgacacggaacccaacgacaacgctttttccaacgca
aactcccacagcgacgccacgctgtcccccgacagagatacgacgggcccacggattaaa
gacggaccaggacgttatgagctttttgcgtttatcagccacatgggagaatcgacaatg
tctggacattatgtttgtcacatcaaaaaggaaggaaggtgggtaatctacaatgaccac
aaagtgtgtttgtcagaaaggcctccgaaggacttgggctacatctacttctaccaccga
ctgtcaagcagttag

DBGET integrated database retrieval system