KEGG   Takifugu rubripes (torafugu): 101067171Help
Entry
101067171         CDS       T02386                                 

Definition
acyl-protein thioesterase 2-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tru00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 230 aa AA seqDB search
MCGNNMSVPLLTNAVTVSGTEKETAVVIFLHGLGDSGHGWTETLTEIQPPYVKFICPHAP
AIPVTLNKNAIMPAWFDLMGLSHDSPEDEAGIKKAAENIKAIIEHEAKNGIPPHRIILGG
FSQGGALSLYTALTCQHQLAGVVALSCWLPLHKSFPSAFSGHKYLPILQCHGEMDFMIPL
RFGDMTSKTIQSIVDPQMVSFKSYAGLPHSSSPQEMADVKEFIEKYLPRI
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaaacaacatgtctgtgccgctgctcaccaatgctgtgacggtgtctgggaca
gagaaggagaccgcagtggttatcttcctccatgggttgggagatagtggtcacggttgg
acagaaactttgacggagattcagcctccgtatgtcaagttcatctgcccccacgcacca
gcaattcctgtcacgctcaacaagaatgcgataatgcctgcgtggtttgacctcatgggt
ctcagccatgactccccagaggatgaagctggtatcaagaaggcagcagaaaacataaag
gccataattgaacatgaggccaaaaatgggatcccccctcaccgtataatccttggtggt
ttttctcagggtggggccttgtctttgtatactgccttgacctgtcagcatcagttagct
ggtgttgtggccctcagctgctggctaccacttcacaagagtttcccatcggcattcagt
ggccacaagtacctccccatcctgcagtgtcacggtgaaatggacttcatgatcccattg
cgtttcggagacatgacgtcaaaaacaatccaatccatagttgaccctcagatggtctcc
ttcaaatcttacgcaggactccctcacagctcctctcctcaggagatggcagatgtaaag
gaattcattgagaagtatttacccagaatctga

DBGET integrated database retrieval system