KEGG   Takifugu rubripes (torafugu): 101067334Help
Entry
101067334         CDS       T02386                                 

Definition
(RefSeq) protein disulfide-isomerase A3-like
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101067334
Enzymes [BR:tru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101067334
Chaperones and folding catalysts [BR:tru03110]
 Protein folding catalysts
  Protein disulfide isomerase
   101067334
Membrane trafficking [BR:tru04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101067334
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101067334
  Exosomal proteins of colorectal cancer cells
   101067334
  Exosomal proteins of bladder cancer cells
   101067334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 TraF Thioredoxin_3 Thioredoxin_8 AhpC-TSA OST3_OST6 Calsequestrin
Motif
Other DBs
NCBI-GeneID: 101067334
NCBI-ProteinID: XP_003969188
Position
12
AA seq 495 aa AA seqDB search
MAAVFRLVSTVSFLLYCFPGASSTRQDVLELGDADFDYLATEHETMLVKFYAPWCGHCKK
LAPTFQKAASRLKGTVQLAKVDCTANTETCSRFGVSGYPTLKIFRSGKDSAPYDGPRTAD
GIYEYMKRQTGPDSLHLKTDEDLQAFIDNYDASIIGVFSGADSSRLSEFLTASSLLREQF
RFAHTTDLKLGEKYGVILSESVLLFRPPRLKNMFEDGMVVFTDHLTIGSLRRFIRDHIYG
LCPHMTVENRERLRARDVLTAFYDLDYHHNIRGSSYWRNRVMKVASKYAGQGLTFSVASK
KDFLSELEEDFGLGMSDGGELPVITIRTRTGHKYTMREEFTRDGKSLERFVDDYLAGRLK
PYVKSEPVPERNVDAVKTVVAETFDAIVNDPGKDALILFYSPSCLHCKKLEPVFRELAGK
LEADPNIVVVKMNAQDNDVPLGYQVQGFPTIYLARAGRKDEPIRYEGGRELRDFLKFLRR
EVGRSLIVDGSKDEL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgttttccgcctcgtctccaccgtctccttcctactttactgttttcctggc
gcgagcagcacgcgccaggacgtgctcgagctcggcgacgcagattttgactacttggca
acggagcacgagaccatgctggtgaaattctacgctccatggtgtggccactgtaaaaaa
ttagctccgaccttccagaaggcagcgagtcgactgaaggggacggttcagctggctaag
gtggactgtaccgccaatactgagacctgcagccggttcggagtgtccgggtatcccacc
ctgaagatcttcaggagcggcaaagactccgccccttacgacggtcctcgcactgccgat
gggatctatgagtacatgaagaggcagactggtccagactctcttcacctgaagacagat
gaagacctgcaggccttcatcgacaactatgatgccagtattattggcgtgttctcaggt
gcggacagttctcgtttgtcagagttcttgacagcgtcgtctttgctaagagagcagttc
cgctttgctcacacaactgacctgaaactgggagagaagtatggcgttattctgagtgag
tcggtgctgctgtttagacccccgagactgaagaatatgtttgaggacggcatggtggtc
ttcacagaccacctgaccatcggctctctgagacgcttcattcgggatcacatttacggt
ctgtgtccacacatgaccgtagaaaatagagagcgtctgagggcccgtgacgtgctgacg
gcgttctacgacctggactaccatcacaacattcggggctccagctactggagaaacagg
gttatgaaggtggcgtccaaatatgctggacagggcctgacattttccgtagccagtaag
aaggacttcctgtctgagctggaggaggactttggtctgggaatgtcagatggaggagag
ctgccggtcatcacaattcgcaccagaacgggccacaagtacaccatgagagaggagttc
acgagggacggtaagtccctagagaggtttgtggatgattacctggcaggtcggctgaaa
ccttacgtgaaatctgaaccggtaccagagagaaacgtggacgcggtgaagacggttgtt
gctgagacttttgacgccatcgtcaatgatcccggtaaagatgccctgatcctcttttac
tcgccgtcgtgtcttcactgtaaaaaactggagccagtcttcagagagttggctgggaag
ctggaggctgatcccaacatcgtggtggtgaagatgaacgcgcaggataacgacgttcct
ctgggttatcaagtgcaggggtttcccaccatttaccttgctcgggctggcaggaaggac
gagcccatccgatatgaggggggtcgcgagctgagggacttcctgaagttcctgcggcgt
gaggtgggacgcagcttgatagtcgatggctcaaaagatgaactgtga

DBGET integrated database retrieval system