KEGG   Takifugu rubripes (torafugu): 101067334Help
Entry
101067334         CDS       T02386                                 

Definition
protein disulfide-isomerase A3-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101067334
Enzymes [BR:tru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101067334
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101067334
  Exosomal proteins of colorectal cancer cells
   101067334
  Exosomal proteins of bladder cancer cells
   101067334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 495 aa AA seqDB search
MAAVFRLVSTVSFLLYCFPGASSTRQDVLELGDADFDYLATEHETMLVKFYAPWCGHCKK
LAPTFQKAASRLKGTVQLAKVDCTANTETCSRFGVSGYPTLKIFRSGKDSAPYDGPRTAD
GIYEYMKRQTGPDSLHLKTDEDLQAFIDNYDASIIGVFSGADSSRLSEFLTASSLLREQF
RFAHTTDLKLGEKYGVILSESVLLFRPPRLKNMFEDGMVVFTDHLTIGSLRRFIRDHIYG
LCPHMTVENRERLRARDVLTAFYDLDYHHNIRGSSYWRNRVMKVASKYAGQGLTFSVASK
KDFLSELEEDFGLGMSDGGELPVITIRTRTGHKYTMREEFTRDGKSLERFVDDYLAGRLK
PYVKSEPVPERNVDAVKTVVAETFDAIVNDPGKDALILFYSPSCLHCKKLEPVFRELAGK
LEADPNIVVVKMNAQDNDVPLGYQVQGFPTIYLARAGRKDEPIRYEGGRELRDFLKFLRR
EVGRSLIVDGSKDEL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgttttccgcctcgtctccaccgtctccttcctactttactgttttcctggc
gcgagcagcacgcgccaggacgtgctcgagctcggcgacgcagattttgactacttggca
acggagcacgagaccatgctggtgaaattctacgctccatggtgtggccactgtaaaaaa
ttagctccgaccttccagaaggcagcgagtcgactgaaggggacggttcagctggctaag
gtggactgtaccgccaatactgagacctgcagccggttcggagtgtccgggtatcccacc
ctgaagatcttcaggagcggcaaagactccgccccttacgacggtcctcgcactgccgat
gggatctatgagtacatgaagaggcagactggtccagactctcttcacctgaagacagat
gaagacctgcaggccttcatcgacaactatgatgccagtattattggcgtgttctcaggt
gcggacagttctcgtttgtcagagttcttgacagcgtcgtctttgctaagagagcagttc
cgctttgctcacacaactgacctgaaactgggagagaagtatggcgttattctgagtgag
tcggtgctgctgtttagacccccgagactgaagaatatgtttgaggacggcatggtggtc
ttcacagaccacctgaccatcggctctctgagacgcttcattcgggatcacatttacggt
ctgtgtccacacatgaccgtagaaaatagagagcgtctgagggcccgtgacgtgctgacg
gcgttctacgacctggactaccatcacaacattcggggctccagctactggagaaacagg
gttatgaaggtggcgtccaaatatgctggacagggcctgacattttccgtagccagtaag
aaggacttcctgtctgagctggaggaggactttggtctgggaatgtcagatggaggagag
ctgccggtcatcacaattcgcaccagaacgggccacaagtacaccatgagagaggagttc
acgagggacggtaagtccctagagaggtttgtggatgattacctggcaggtcggctgaaa
ccttacgtgaaatctgaaccggtaccagagagaaacgtggacgcggtgaagacggttgtt
gctgagacttttgacgccatcgtcaatgatcccggtaaagatgccctgatcctcttttac
tcgccgtcgtgtcttcactgtaaaaaactggagccagtcttcagagagttggctgggaag
ctggaggctgatcccaacatcgtggtggtgaagatgaacgcgcaggataacgacgttcct
ctgggttatcaagtgcaggggtttcccaccatttaccttgctcgggctggcaggaaggac
gagcccatccgatatgaggggggtcgcgagctgagggacttcctgaagttcctgcggcgt
gaggtgggacgcagcttgatagtcgatggctcaaaagatgaactgtga

DBGET integrated database retrieval system