KEGG   Takifugu rubripes (torafugu): 101067521Help
Entry
101067521         CDS       T02386                                 

Definition
serine/threonine-protein kinase mos-like
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Module
MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101067521
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101067521
  Cell growth and death
   04114 Oocyte meiosis
    101067521
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101067521
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101067521
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: Other group
  MOS family
   101067521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 337 aa AA seqDB search
MPSPIPVTRLLPKDIYPSLDIGICSSPLAKPSCGSTLQVPGQRFHRKTGTRLWSSVIHWE
QLRSIESVGSGGFGSVYKADYFGKTVALKKVKKQTKNRLASRQSFWAELNAAHLRHTHVV
RIIAATTCIPLECEDTNNIGMILMEYVGSRNLHQLIYECVEPLHEDRWLRYSVHIAHGLR
FLHSHDIVHLDIKPANVLVSSEDLCKIADFGSSLKLERGCEVSACSASVSHVGGTYTHRA
PELLKGEAVSPTADIFSFGITMWQLITRKQPYTGDRQHVLYAVVAHNLRPCVQQPEFVSE
QGQSSRSLLERCWSREASCRPTAQELVPSLEQLRSSL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgccctctccgatccccgtcactcgcctgttgcccaaagacatctacccgtctctggat
atcgggatctgcagcagcccactggccaaaccctcctgcgggtctacgttacaggtgccg
ggccagcgcttccataggaagaccgggacccggctctggtcttctgtgattcactgggag
cagctgcgctccattgagtctgtgggctccggggggttcggttctgtctacaaggccgat
tattttgggaagactgttgccctgaagaaagtaaaaaaacaaaccaaaaacaggctggcg
tcccgacagagcttctgggccgagctgaacgcggcgcacctgcgccacacgcacgtcgtg
cgcatcattgcggccaccacctgcattccgctggaatgtgaagataccaacaatatcggg
atgatcctgatggagtatgtgggcagcaggaatctgcatcaactcatctacgagtgcgtg
gagccgctgcacgaggacaggtggctcaggtactctgtgcacatcgcgcacgggttgcgc
ttccttcactctcacgacatcgtacatttggacataaaaccagccaacgtgttggtatcc
agtgaagacctctgcaaaattgcggactttggttcctctttgaaactggagcgtgggtgc
gaggtcagtgcgtgcagcgcaagtgtgagtcacgtgggaggcacgtacacgcacagggcg
ccggagctgctgaaaggcgaggcggtgtctcccacagcagatatcttctcctttgggata
accatgtggcagctgatcaccaggaagcagccgtacacaggcgaccggcagcacgtgctc
tacgctgtcgtggcgcacaacctccgtccttgtgtccagcagccggagtttgtctcggag
cagggccagagcagcaggagcctgctggagcggtgctggagcagggaggccagctgcaga
cccactgcccaagaactggtgccttccttggagcagctgcgctcctcactgtag

DBGET integrated database retrieval system