KEGG   Takifugu rubripes (torafugu): 101067638Help
Entry
101067638         CDS       T02386                                 

Definition
profilin-2-like
Orthology
K05759  
profilin
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101067638
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    101067638
Exosome [BR:tru04147]
 Exosomal proteins
  Proteins found in most exosomes
   101067638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22
AA seq 139 aa AA seqDB search
MSWQSYVDNLMADGSCQDSAIVGYTDAKYVWAAHAGGTFNNITCQEIDVVVGKDRETFYT
SGLTLGSKKCSVLRDSLHDDGDWTMDIRTKSQGGEPTYNISVGKAGKVLVLVMGKEGVHG
GGLNKKAFSMAKYLRDSGF
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcagagctacgtggacaatctgatggccgatggcagctgtcaggatagcgcc
attgttgggtacacggacgccaaatatgtttgggcagcacatgccggtggtactttcaat
aatatcacgtgtcaagaaattgacgtggtggtcggtaaggacagggagaccttttacacc
agcggtcttactttgggctcaaagaagtgttcagtcctcagagacagcctccatgatgac
ggcgactggacaatggacatcaggacaaagagccagggaggagagcccacgtacaacatc
tctgtggggaaggccgggaaagttttggttcttgtaatgggcaaagaaggggtccacgga
ggcggattgaataagaaggctttctcaatggccaaatacttgagggattcaggcttttaa

DBGET integrated database retrieval system