KEGG   Takifugu rubripes (torafugu): 101067757Help
Entry
101067757         CDS       T02386                                 

Definition
(RefSeq) probable ubiquitin carboxyl-terminal hydrolase FAF-X
  KO
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101067757
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101067757
Ubiquitin system [BR:tru04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101067757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 2621 aa AA seqDB search
MTATTRGSPVGGNESQGQAPDAQSQPPLPQNQTSSPNSSNENSPVSPTDEQGQGDGTHRL
EKEEPAFPHADLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKCEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMATNP
HCKFHIYNGTRPSESVPAGAQLADDELFARPPDPRSPKGWLVDLINKFGTLNGFQILHDR
FMSGQALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPVIEMVPQFLENLTDEELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHNPEEEEWLTAERMAEWIQQNHILSIVLRDSLHQPQYVEKLEKILRFVI
KEKALTMQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNASK
KQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDQALSAHIKILDYSCS
QDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRHD
LINQLQHNHALVTLVAENLSAYMETMRQLSKEEQAEFDPQTVRPGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVFLCDREACFKWYSKLMGDEPDLDPDINKDFF
ENNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
GSDDIASRAIDLLKEIYTNLGPKLQVNQVEIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAIRMVRVLTVLKEYINECDSDYHEERTILPMSRAFRGKHITLIIRFPNQGRQVD
DLDIWSHTNDTIGSVRRNILNRIKANAAHTKIELFIGGEVVDPADDRKLIGQLNLKDKTL
ITAKLTQVSTNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLHLRYISF
LWQVADLGCNLNMPLLRDGARVLMKLMPPDNTTVENLRAICLDHAKLGENSLSPSLDSRF
FGPSPSQVLYLIEVVYALLMPASATLGEDASDFQYNFLKSGGLPLVLSMLTRNNFLPSAD
METRRGAYLNALKIAKLLLTAVGFGHVKAVAEACQPSADGNIPVSPVRQLINQATHDQAL
VLQNALQNIPNPASECMLRNVAIRLAQQISDESFFQASKYIPDICVIRAVQKIVWASGCG
TIQLVFSSNEEISKIYEKTNAAKEPDGEDEQVCCEALEVMTLCFALTPTTLDTLSKEKAW
QTFIIDLLLHCHSKSVRQMAQEQFFLMATRCCMGHRPLLFFITLLFTVLGSTAKERAKHA
GDYFTLLRHLLNYAYNSNINLPNAEVLLNNEIDWLKRIRDEVKRTGETGVEETILEGHLG
VTKELLAFQTQEKKYYIGCEKGGANLIKELIDDFIFPASNVYLQYMKSGEFPTEQAIPVC
STPASINAGFELLVALAVGCVRNLKQIVDTLTDMYYLGCETLTEWEYLPPVGPRPNKGFV
GLKNAGATCYMNSVIQQLYMIPPIRNGILAIEGTGTDVDDDMSGDEKQENESNVDPRDEV
FSYHHQFDDKPSSKSEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPV
NLREQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFT
TLNVDIRNHQNLLDSMEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLK
RFDYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDDVNPENQVIQQNEPSEPTPS
GSSKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDEEEMKN
QCFGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERMDSLDKDNEIVKYISDLTISATK
PHQVKMPGVIECSVRKQNVQFMHNRMQYSLEYFQFIKKLLTCNSVYLNPPPGQDHLLPEA
EEIAMISAQLAARFLFSTGFHTKKVVRGPASDWYDALCILLRHSKNVRFWFAHNVLFAYP
NRFSEYLLECPSAEVRGAFAKLIVFIAHFSLPDGSCPSPTASPGPSAQGCDNLSLSDHLL
RAVLNLLRREVSEHGRHLQQYFNLFVMYANLGKELALGHSAATTTCSSVNCLAEKTQLLK
LNVPATFMLVALDEGPGPPIKYQYAELGKLYTVVSQLVRCCDVSSRMQSSINGNPPLPNP
YGDTNLTAPVMPVQPLVAEILFVRTSYVKKIIEDCSNSEETVKLLRFSCWENPQFSSTVL
SELLWQVAYSYTYELRPYLDLLLQILLIEDSWQTHRIHNVLKGIPDDRDGLFDTIQRSKN
HYQKRAYQCIKCMVALFSNCSVAYQILQSNGDLKRKWTWAVEWLGDELERRPYTGNPQYT
YNNWSPPVQSNETSNGYFLERSHSARMTLAKACELCPEEEPDEQEAPDDQDTSPPEDTSL
YPHSPGTTQFQQNNHPHGQPYTGPAAQHMNNPQRPGPASAPTPGPNQNPNPNPNPNPTPN
PTLTPASTTPAPGPRAQENWESTEEVAPAPTTIPAPAPPKE
NT seq 7866 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaccacgcgtggctctccggtggggggcaatgagagccagggccaggcaccc
gatgctcagagccagccaccgttgccacagaaccagacatcatctcctaactcgtcaaat
gagaactctccagtgagcccaacagatgagcaaggccaaggagacgggacacatcggcta
gagaaggaggaaccggccttcccacacgccgacctggccaagctggacgacatgatcaac
aggcctcgttgggttgtgccagttttgccaaaaggagaactagaagttcttttggaagct
gcaatcgacctgagtaaaaaaggactggatgtgaaatgtgaggcatgtcagaggtttttc
cgagatggtctaacaatctcctttaccaagatcctgacagatgaggccgtcagtggctgg
aagtttgagatccacaggtgcatcatcaataacacccaccgtttagtggagttatgtgtg
gccaagctctctcaggactggtttccactgctggagctgttggccatggcaacgaaccct
cactgcaagttccacatatacaatggcactcggccttctgaatctgtcccagccggggca
cagcttgctgacgatgagctctttgcccgaccaccggatcctcgctctcccaagggctgg
ttggtggacttgataaacaagtttggcacgttaaatggttttcaaattttgcacgatcgc
ttcatgagtggccaagcactgaacgtccagatcatcgctgcacttataaaaccttttggc
cagtgttacgagttcctcacattgcacactgtaaagaagtacttccttccagtcattgag
atggttccccagtttctagagaatctgacagatgaggagttgaaaaaagaggccaagaat
gaagccaaaaacgacgcactgtccatgataatcaagtctctgaagaatctggcctcccga
gtacctgggcaggaggagactgtgaagaatttagaaatttttaggttaaaaatgatactt
aggttattgcaaatttcttcttttaatggcaaaatgaatgcactaaatgaagttaataag
gtaatctctagtgtgtcctactacactcatcggcataacccagaggaggaggaatggctg
actgctgaacgcatggcggagtggatccaacagaaccacatcctgtctattgtgctgcgt
gacagtttgcatcagccacagtatgttgagaaactggagaagatccttcgctttgtcatc
aaagagaaggctctgacaatgcaggacctggacaacatctgggcagcgcaggctggcaaa
catgaggcaattgtaaaaaatgtacatgacctgctggcaaagctggcctgggacttctca
ccagagcagcttgaccacctatttgactgtttcaaggcaagctggaccaatgctagcaaa
aagcagcgtgagaaactgttggaactcatcagacgcttggctgaagatgataaagatggg
gtgatggcccacaaggtcttgaacctgttgtggaatttggcacacagtgatgacgtacct
gtagatatcatggaccaagctcttagtgctcacatcaaaatactagactacagttgctct
caggacagagacacacagaagattcaatggatagatcgtttcatagaggagctacgaacc
aatgacaagtgggtgattcctgccctgaagcaaatcagagaaatctgcagcctctttggt
gaagccccacaaaacctcagtcaaacccagagaagtcctcatgtcttttaccgccatgac
cttatcaaccagcttcaacacaaccatgctctggtgaccctggtcgctgaaaatctttca
gcttacatggaaacaatgaggcagttgtctaaagaagaacaagctgagtttgaccctcag
acagtcaggccaggtagccgctacagccatgtccaggaagtccaagaacgacttaacttt
ttgaggttcctgctaaaagatggccagttgtggttgtgtgcccctcaagctaagcagatc
tggaagtgtttggctgagaatgcagtgtttttgtgtgatcgtgaggcctgcttcaagtgg
tactccaagctcatgggagatgagccagacctggatccagacataaataaggactttttt
gaaaacaatgtcctgcagttggacccttctctattaacagagaacggcatgaagtgcttt
gagaggttcttcaaggctgtcaactgcagggaaggcaagctggtagcaaagcgcagggcc
tatatgatggatgatctagagctaataggccttgattacctctggagggtggtaatacaa
ggaagtgatgacattgcaagcagagccatagatttgctaaaggagatctacaccaatctt
ggaccaaaactgcaagtcaatcaggttgaaattcacgaagatttcatccagtcatgtttt
gaccgtctgaaggcgtcctatgacaccctgtgtgtgttagatggagacaaagacagtatc
aactgtgctcgtcaagaggctattcgcatggtgcgagttctcactgtgcttaaagagtac
atcaatgaatgtgacagtgactaccacgaggagaggactatactgcccatgtcaagagct
ttccgtgggaaacatatcactttgatcattcgtttcccaaaccaggggcgtcaggtagat
gatttggatatctggtcacacacaaatgatacaataggctcagtacggcgcaacatcctg
aacagaatcaaggccaatgctgctcataccaaaattgagctatttattggtggagaggtt
gttgaccccgccgacgacaggaagctgattggacagctcaatttgaaagacaaaacgctg
attacagccaagctgacccaggtgagtaccaacatgccctccagtccagacagctcctct
gactcatctactgggtcccctggcaaccatggaaaccactacagtgatgggcccaaccca
gaagtagaaagttgtcttcctggtgtgattatgtccttgcatttgcgatacatctccttc
ctttggcaagtagctgatctgggctgcaacctcaacatgccactacttcgagatggagct
cgggttcttatgaaacttatgcccccagataacactacagtagaaaatctcagagccata
tgtttggaccatgcaaaacttggagagaacagtctcagtccatcacttgactcgagattt
tttggaccttcgccttcacaagtcctctacctcatagaggttgtgtatgctttactgatg
ccagccagtgccactctgggcgaggacgccagtgattttcagtacaacttcttaaaaagt
ggtggccttcccctggtattgagcatgcttaccaggaacaacttcctcccttctgcagat
atggagacccggcgtggggcttacctcaatgcacttaaaattgcaaagctcctcctcaca
gctgtaggatttggacatgtcaaagctgtagctgaagcctgccaacccagtgctgatgga
aatattcccgtgtcaccggtgaggcaactgataaatcaagctactcacgaccaggctctg
gtcctccagaatgccttacaaaacatccccaaccctgcatcagaatgcatgctgcgcaat
gtagccatccgcctggcccaacagatatctgatgagagctttttccaggcatcaaagtac
atcccagatatatgtgtgattcgtgcagttcagaaaatagtgtgggcgtcaggctgcggt
acaatacagctcgtcttcagttcaaatgaagaaattagcaagatatacgagaagacaaat
gcagctaaggagccggatggagaagacgagcaggtgtgctgcgaggccctggaagtaatg
acattatgctttgccctcacgcccacaactctggacacactcagtaaggagaaggcttgg
cagacttttatcatagacttgcttctgcactgccacagcaaatctgtacgtcagatggcc
caggaacagtttttcctaatggcaactcgatgttgcatgggtcatcgacccctgctgttc
ttcatcaccctcctcttcactgtgctagggagtacagccaaagagcgcgccaaacatgct
ggggactacttcaccttactcagacatcttttgaactatgcctataatagcaacatcaac
cttccaaatgctgaagtgctcctcaacaatgaaattgactggctgaaaaggatacgggat
gaggttaaacggacgggagagactggtgttgaagagaccatcttggagggacaccttgga
gtcacaaaggagcttttagcattccagacacaggagaagaaatattacattggctgtgag
aaggggggagcaaatctcattaaggagttgattgatgacttcatcttcccggcgtccaat
gtttaccttcagtacatgaaaagtggagagtttcccaccgagcaggccatcccagtctgc
agcacccctgcttctatcaatgctggctttgaactattggtagcattggcagtaggctgt
gtccgtaacctcaagcaaatagttgataccctgactgacatgtactacttgggttgtgag
acactaacagaatgggagtacttgcctccagttgggccacggcctaataaaggctttgtg
ggactgaagaatgctggggccacctgttacatgaactcggtcattcagcagctatacatg
atccctcccatccgcaatggcatcctcgccatcgaggggacgggcactgatgtggatgat
gacatgtctggagatgagaagcaggaaaatgagagtaatgtggatcctcgggatgaagta
ttcagctaccaccatcaatttgatgataaaccctccagtaagtcagaagacaggaaagaa
tacaacatcggggtattgcggcatctgcaagtcatttttggacatttggccgcctcacgg
ctgcagtactatgttccaagggggttctggaaacagttcagattgtggggtgagccagta
aacctgcgagagcaacatgatgccctagagtttttcaactctctggtagacagtttagat
gaagccctgaaagccctgggccaccctgccatgctcagcaaggtgctgggaggatcattt
gctgaccaaaagatttgtcaggggtgcccacacaggtacgagtgtgaggagtcattcaca
actctgaatgtagacatcagaaaccaccagaacctgttggattccatggagcaatatgtt
aaaggagatttgctggagggagccaacgcttaccactgtgaaaagtgtaataagaaggtg
gatacggtgaagcgcctcctgattaagaagctgccacctgtcctggctattcaactgaag
cgctttgactatgactgggagagagagtgtgccatcaagtttaatgactactttgagttc
cccagggagctggacatggagccatacactgtagcaggtgtggccaagctcgagggagac
gacgttaacccggagaatcaggtcatccaacagaatgagccctctgaaccgacaccttca
gggagctccaagtatcgtctggtgggagtgctggtacactcaggacaggccagcggtggg
cactattattcctacataattcagaggaacggaggagatggtgagaaaaaccgctggtac
aaatttgatgacggcgacgtgactgagtgcaagatggacgatgaggaggaaatgaagaac
caatgttttggaggagagtacatgggcgaggtgtttgatcacatgatgaagaggatgtca
tatcgaagacagaaacggtggtggaatgcctacatcctgttttatgagagaatggactca
cttgacaaggacaacgagattgtgaaatacatctctgatttgaccatctccgccacaaaa
cctcatcaggtcaagatgcctggtgtcatcgagtgcagcgtccgcaagcagaacgtccag
ttcatgcataatcgaatgcaatacagcctggaatatttccagttcattaagaaacttctg
acctgtaacagtgtctatttaaaccctcctccaggacaagatcatcttctcccagaagct
gaggaaattgcaatgatcagtgctcagcttgctgccaggttcctcttcagtacaggtttt
cacaccaaaaaagtcgtgcggggccctgccagtgactggtatgatgccctctgcatcctg
ctgagacacagtaagaatgtacgcttctggtttgcacacaacgttttgtttgcgtaccct
aaccgcttctcggagtacctgctggagtgccccagcgctgaggtccgtggtgcttttgcc
aagctcatcgtcttcatagctcacttttccctgccagacggctcgtgcccctccccgaca
gcctcacccggaccttctgctcagggttgtgataacctcagtttaagcgaccacctgttg
agagccgtactcaacctgctccgaagagaggtttccgaacacggccgtcacctgcagcag
tacttcaacctctttgtcatgtatgccaacctcggtaaggagctcgcgttgggtcactca
gccgccacgaccacctgctcctccgtgaattgcctggcagagaaaacccagctcttgaag
ctgaacgttccagctactttcatgttggtcgctctggatgaaggtcctggccccccaatt
aaataccagtatgctgagctgggaaaactctacactgtggtctcccagctcgtgcgctgc
tgtgacgtgtcctcgcgcatgcagtcgtccataaatggaaatcctccgctcccgaaccca
tacggggacaccaacctcacagctccggtgatgcctgtgcagccactggtggcagagatc
ctgtttgtgaggaccagctatgtgaagaagatcatcgaggattgcagcaactctgaggag
acggtgaagctgcttcgcttcagctgctgggagaaccctcagttctcctccaccgtgctc
agtgagctgctctggcaggtggcctactcttacacctacgagctgaggccctacttggac
ctgctgctccagattctgctgattgaggactcctggcagacgcacaggatccacaacgtg
ttgaagggcataccggatgacagagatgggctctttgataccatccagcgctcaaagaac
cactaccagaaacgcgcctaccagtgcatcaagtgcatggtggcgctcttcagcaactgt
tctgtggcctaccagatcttacagagtaatggtgacctgaaacggaagtggacctgggcg
gtggagtggttaggggatgagctggagaggaggccttatactgggaaccctcagtacacc
tacaacaactggtcacctccagttcagagcaacgagacctccaacggctacttcctggag
cgctctcacagcgctcgcatgacattggccaaagcttgtgaactttgtcctgaagaggag
cctgatgagcaggaggcgcctgatgatcaggacacctcccctcctgaagacacctctttg
tatccacattctcctgggacaacccagtttcagcagaacaaccacccccatgggcaacct
tacactggtcctgctgctcagcacatgaacaacccccagcgtcctggtcctgcttctgcc
ccgactcctggccccaaccagaacccaaacccgaacccgaacccgaacccaaccccaaac
ccaaccctcacccctgctagcaccactcccgcaccagggccacgagcacaagaaaactgg
gagagcaccgaggaggtcgctcctgccccgaccacgataccagcgcccgcgccaccgaaa
gaataa

DBGET integrated database retrieval system