KEGG   Takifugu rubripes (torafugu): 101067816Help
Entry
101067816         CDS       T02386                                 

Definition
receptor-type tyrosine-protein phosphatase R-like
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tru04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 724 aa AA seqDB search
MSGLLALIWTQWLITGLRWTVGEIGSFRQKLLLVIVGSISFRLATLPISTAHVARMLFQK
LARSTSATTEPGLDQEPGLDQEPIDGGQAALNLLARPHEQVQPETSEVSGRHLVTVELQA
EGERTVVVLTVVVLTVVVLTVVVLTCLLTVVVLTVVVLTVVVLTVVVLAVDVRRLNISLL
LWFREGVAAALGVAAGQVHIHRLNEEKNGIELFVSSAGPGLSEPRPAEEVIQALNIRVLH
QHLGHWGITEISTEKNVLQDGQRDPVWNLEGFYALVLFFTIFIIITTCLMVLYQLKEKVQ
LSDTAVKAPRHGQDLSHPGPPDSAQRSKGTKLPSSGSMVQAALPPAVATPTPQQQPITAC
RHLAPPVSRPVPVLTDNSVAITTNHDLKLCPSPFKMKPAAGLQERRGSNVSLVLDMSALG
SVEPMTVAVVTPREAAAREYLLSASRPLTRQQVHDLVNNTHKLQAEFAEIPMNFIDPKEL
DIPNHGTKNRYKTILPNPHSRVVLKSKSLNDPLSSYINANYIRGYRGDERAFIATQGPMV
NTVNDFWQMAWQEEAPAIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVGGLRECEHYST
RSLTLKCGNQTRVLQHYWYTSWPDHKTPDSTLPLLQLMADVEADRRAAGGGPVVVHCSAG
IGRTGCFIATTIGCRQLELEGVVDVLSITCQLRADRGGMIQTGEQYEFVHHALSLYEAAA
ETGQ
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggctactggctttaatatggacacagtggctgatcacaggactgcgttggact
gtgggcgagatcggcagctttagacagaagcttcttctggtgatcgtgggatctatctct
ttccgtctcgccactctccccatctccaccgcccacgtggcgaggatgctcttccagaag
ctcgcccgcagcacctccgccaccaccgagcctggcttggatcaggagcctggcttggat
caggagcccattgatggtgggcaggcagccctcaatctgctggcacggccacatgagcag
gtgcagcctgagaccagcgaggtgtcaggacggcacctggtaaccgtggagctgcaagct
gagggagagcggaccgtggtggttctgactgtggtggttctgaccgtggtggttctgacc
gtggtggttctgacatgtctgctgactgtggtggttctgaccgtggtggttctgactgtg
gtggttctgaccgttgtggtcctggctgtggatgtgaggaggctgaacatcagtcttctt
ctgtggtttcgggaaggcgtggcagcagcgttgggtgttgctgcgggacaagtgcacatc
cacaggctgaacgaggagaagaacggcatcgagctgttcgtgtcctccgccgggccgggc
ctctctgagccccgccccgccgaggaggtcatccaggccctgaacatcagggtcctgcac
caacacctgggacactggggcatcactgagatctccacagagaagaacgtcctgcaggat
gggcagagggaccccgtgtggaacctagaaggtttttatgcactcgtcctcttcttcacc
atcttcatcatcatcaccacctgcttgatggttttgtaccaactgaaggagaaggttcaa
ctttctgacacagcggtaaaagcgccgcgccacggtcaggacctgagccaccctggcccc
ccagactccgctcagaggtcaaagggcaccaagcttccatcatcaggaagcatggtccaa
gctgcgctcccgccagctgtagccacgcccaccccccagcagcagccaatcacagcctgc
cgccacctcgctccccctgtgtccaggcctgtcccagttctcactgacaacagcgttgct
ataacaaccaaccacgacctgaagctttgcccctcccctttcaagatgaaacctgcagca
ggacttcaggaaagacggggctccaacgtctctctggtgttggacatgtctgcgctgggc
tcggtggaacccatgactgttgccgtggtaacccccagagaagccgctgccagggaatac
ctgctgtcggcaagtcggcccctgacgcgccagcaagtgcacgacctcgtcaacaacacg
cacaagctgcaggccgagtttgctgaaatccccatgaatttcatcgatcccaaagaactg
gacatcccaaaccacgggaccaagaaccggtacaagaccatcctgcccaaccctcattcc
agagtcgttctgaagtcaaagagcctcaacgaccctctgagctcctacatcaacgccaac
tacatacgtggttaccgtggtgacgagagggcgttcatcgccacccagggtccgatggtg
aacacggtcaacgacttctggcagatggcgtggcaggaggaggcgcccgccatcgtcatg
atcaccaagctgaaggagaagaacgagaagtgtgttctgtactggcccgagaagagaggc
atctacgggaaggtggaggttctggtcggcgggctcagggagtgcgagcactacagcacg
cgcagcctcacgctgaagtgtgggaaccaaacccgtgtcctgcagcactactggtacacg
tcctggcccgaccacaagacccccgactccacgctgccgctgctgcagctgatggccgac
gtggaggcggacagacgggcggccggcgggggcccggtcgtggtccactgcagcgccggg
atcggccggaccggctgcttcatcgccacgacgataggctgtcggcagctggagctggag
ggcgtggtggacgtgctgagcatcacctgccagctgcgagccgacaggggggggatgatc
cagactggggagcagtacgagtttgtccatcacgccctgagtctgtacgaagcggctgca
gaaacgggccagtga

DBGET integrated database retrieval system