KEGG   Takifugu rubripes (torafugu): 101067839Help
Entry
101067839         CDS       T02386                                 

Gene name
mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101067839 (mapk10)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101067839 (mapk10)
   04012 ErbB signaling pathway
    101067839 (mapk10)
   04310 Wnt signaling pathway
    101067839 (mapk10)
   04068 FoxO signaling pathway
    101067839 (mapk10)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    101067839 (mapk10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101067839 (mapk10)
   04621 NOD-like receptor signaling pathway
    101067839 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    101067839 (mapk10)
  Endocrine system
   04910 Insulin signaling pathway
    101067839 (mapk10)
   04920 Adipocytokine signaling pathway
    101067839 (mapk10)
   04912 GnRH signaling pathway
    101067839 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    101067839 (mapk10)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    101067839 (mapk10)
   05168 Herpes simplex infection
    101067839 (mapk10)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101067839 (mapk10)
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101067839 (mapk10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 467 aa AA seqDB search
MVFMSRHFLYNCSQPILDVKIAFCQGFGQQVDVSYIAKHYNMSKSKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHP
YINVWYDPAEVEAPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNGVVKGQPSPS
GAAVNSSESPPPSSSINDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtctttatgagcagacatttcttatataactgcagccaaccgatcctggatgtgaag
attgccttttgtcagggttttggacaacaagtggatgtatcatatattgccaaacattac
aacatgagcaaaagcaaagtggacaaccagttttacagcgtggaggtgggggactccacc
ttcacggtcttaaaacgctaccagaatttgaagcccatcggctctggagctcagggaatt
gtctgcgcgggctacgatgccgtcctagacagaaatgtggccatcaagaagctgagcaga
cccttccagaaccagacccatgccaagagggcataccgggagctcgtgctcatgaaatgc
gtcaatcacaaaaacatcatcagtttattaaatgtcttcacaccacagaaatcattagag
gaattccaggatgtctatctagtcatggagctgatggacgccaacctctgccaggtgatt
cagatggagctcgaccatgagagaatgtcctacctgctctaccaaatgttgtgtgggatc
aaacatctgcactcagccggcattatccacagggacctcaaaccgagcaacatagtggta
aagtcggactgcaccctgaaaatcctggactttggcctggctcggactgcaggcaccagc
ttcatgatgaccccctacgtggtgacgagatactacagagccccagaggtgatcctcggc
atgggctacaaggagaacgtggatatttggtcggtggggtgcattatgggagaaatggtg
cgccacaaaatcctcttccccgggcgggactacatcgaccagtggaacaaggtgatcgag
cagctgggaacaccctctccagagttcatgaagaagcttcagcccacagtgaggaactac
gtcgagaaccggccgaagtacgccggcctcacctttcccaaactgttccccgactgcctt
ttccctgctgactcggagcacaacaaactcaaagccagccaggccagagacctgctgtcc
aagatgctgattatcgaccctgctaaaagaatatcggtggatgaggccttgcagcacccc
tacatcaatgtgtggtacgatccagctgaagtggaggcgccccctccacagatctatgac
aaacagctggatgaaagagaacactccattgatgaatggaaagaactaatttacaaagag
gtgatgaactttgaggagagaacgaagaatggcgttgtgaagggacagccttcaccttca
ggtgcagccgtgaacagcagcgaaagcccccctccctcctcctccatcaacgacatctcc
tccatgtccaccgaccagaccctggcatccgacactgacagcagcctggagacctctgca
ggaccactggggtgttgcaggtga

DBGET integrated database retrieval system