KEGG   Takifugu rubripes (torafugu): 101067839Help
Entry
101067839         CDS       T02386                                 

Definition
mitogen-activated protein kinase 10-like
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tru04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tru04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:tru04012]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:tru04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tru04068]
Cellular Processes; Cell communication; Focal adhesion [PATH:tru04510]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:tru04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:tru04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:tru04622]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:tru04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:tru04920]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:tru04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:tru04914]
Human Diseases; Infectious diseases; Salmonella infection [PATH:tru05132]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:tru05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 464 aa AA seqDB search
MSRHFLYNCSQPILDVKIAFCQGFGQQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNGVVKGQPSPSGAA
VNSSESPPPSSSINDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacatttcttatataactgcagccaaccgatcctggatgtgaagattgccttt
tgtcagggttttggacaacaagtggatgtatcatatattgccaaacattacaacatgagc
aaaagcaaagtggacaaccagttttacagcgtggaggtgggggactccaccttcacggtc
ttaaaacgctaccagaatttgaagcccatcggctctggagctcagggaattgtctgcgcg
ggctacgatgccgtcctagacagaaatgtggccatcaagaagctgagcagacccttccag
aaccagacccatgccaagagggcataccgggagctcgtgctcatgaaatgcgtcaatcac
aaaaacatcatcagtttattaaatgtcttcacaccacagaaatcattagaggaattccag
gatgtctatctagtcatggagctgatggacgccaacctctgccaggtgattcagatggag
ctcgaccatgagagaatgtcctacctgctctaccaaatgttgtgtgggatcaaacatctg
cactcagccggcattatccacagggacctcaaaccgagcaacatagtggtaaagtcggac
tgcaccctgaaaatcctggactttggcctggctcggactgcaggcaccagcttcatgatg
accccctacgtggtgacgagatactacagagccccagaggtgatcctcggcatgggctac
aaggagaacgtggatatttggtcggtggggtgcattatgggagaaatggtgcgccacaaa
atcctcttccccgggcgggactacatcgaccagtggaacaaggtgatcgagcagctggga
acaccctctccagagttcatgaagaagcttcagcccacagtgaggaactacgtcgagaac
cggccgaagtacgccggcctcacctttcccaaactgttccccgactgccttttccctgct
gactcggagcacaacaaactcaaagccagccaggccagagacctgctgtccaagatgctg
attatcgaccctgctaaaagaatatcggtggatgaggccttgcagcacccctacatcaat
gtgtggtacgatccagctgaagtggaggcgccccctccacagatctatgacaaacagctg
gatgaaagagaacactccattgatgaatggaaagaactaatttacaaagaggtgatgaac
tttgaggagagaacgaagaatggcgttgtgaagggacagccttcaccttcaggtgcagcc
gtgaacagcagcgaaagcccccctccctcctcctccatcaacgacatctcctccatgtcc
accgaccagaccctggcatccgacactgacagcagcctggagacctctgcaggaccactg
gggtgttgcaggtga

DBGET integrated database retrieval system