KEGG   Takifugu rubripes (torafugu): 101068167Help
Entry
101068167         CDS       T02386                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 47-like
  KO
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101068167
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101068167
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 1387 aa AA seqDB search
MVPSEETQFVPKEAMFWSCRKSVFDEMKRRSQIHNAAEEPRALCIIQDTTNARTVTERLT
LNLPASTPLSKLHEDVAHKAGYVTGTFELTWGNAPNTAPLDHRSEMSLSDSGFEPGGKRN
FLHITDKDGEQPQLASDESGAADSSGLDDSSQERFIGPLPREGSVGCSGDYSSPSYSYSS
ILTKSDTGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYNWEFEESEEDPVTSIPYQLQR
LFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTVQADLIN
QLYQGKLKDYVRCLECGYESWRIDTYLDIPLVIRPFGASQAYGSVEEALQAFIQPETLDG
PNQYFCERCQKKCDARKGLRFLHFPYLLTLQLKRFDFDYNTMHRIKLNDRMTFPEELDMS
PFIDVEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDCVDEGICLDSTNNADRMLKP
KSLPTFELFSVMVHSGSAAGGHYYAHIKSFSDGQWYSFNDQHVSKITQDDIRKTYGGSSG
SRGYYSSAFASSTNAYMLIYRLKDPSRNAKYLSVEDFPEHIKSLVQKEKESEEQEKRQRE
IERNTCKIKLFCMHPVKMMMESKLEVHKDKTLREATEMAYKLMELEGLVTLDCCRLVKYD
EFHEYLERSYEGEEDTPMGLLLGGVKSSYMFDLLLETRRPDQVFQPYKPGEVMVKVHVVD
LESETIAASVSVRAYLNQTVTEFKQLIAQATGLSAETMRVVLERCYNDLRLLYVPNKTLK
AEGFFRSNKVFVESSISSDHQVTFSDSLLWKLLDRHGNTIRLLVLLPEQSPGTSTNRTVC
QKVGVDSDPSLDGSKGNRKSVEAILEESTEKLKNLSLQQQQQQQQQQQQGSSTSDSQKSS
DASDFEHIESPTQDADSNSLLGEAADNRELENRIRMAGSSGASSDPENHFACEERSDSEV
NNDRSTSSVDSDILSSSHSSDTLCNADSGPLALANGLDSHSITSSRRSKAHEGKKETWDT
AEEDSGTDSEYDDNGKSKGEAQYLYFRTEPCSQSDSTCDAQKCLVVYVDKRITLAAFKQN
LEPYVGVPSAQFKVFRVYANNQEFESIRLNETLSSFSDDNKITIRLGRALKKGEYRVKVY
QLLVNEAEPCKFLVDTVFAKGMTVRQSKEELLPLLKEQCKLDLNIDRVRLRKKTWKNPGT
VFLDYHVYEEDISISSNWEVFLEVLNESEKMKSMSQLAVLTRRWSPSTMKLGPFQEVILE
NSSVDELKEKLSEMSDITLENLDFAKGRGTFPCDISVLEIQQDLDWNPKVSTLNVWPLYI
CDDGAVVFYRNSTEEPMELSEDERSELMKRESSRLLKTGHRVSYSPRKEKALKIYLDGGP
AKDPGQD
NT seq 4164 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctagcgaggagacccagttcgtacctaaagaggcgatgttttggagttgcagg
aagagtgtttttgatgagatgaagaggagatctcagatccacaacgctgccgaggagcct
cgtgcgctgtgcataattcaggacaccaccaacgcgaggacggtcaccgagcggctcacc
ctgaacctgcccgcctccacccccctgtccaagctccacgaagatgtggcccacaaagcc
ggatacgtcacgggcacctttgagctgacctggggaaacgcacctaacacggcgccgctg
gaccaccggagtgagatgtccctctccgattctgggttcgagcccggtggcaaaagaaac
tttctccacattactgacaaagatggagaacagccccagcttgcatctgatgaatcggga
gctgctgatagcagcgggctggatgacagctcccaggagcgcttcatcgggcccctcccc
cgagaaggctccgtaggctgcagtggtgattacagcagtccatcctactcttactcgtct
attctcaccaaatctgatacaggttacgtcggtctggtcaaccaggctatgacctgttat
ctcaacagccttctgcagactctgttcatgactccagaattcagaaacgcactctacaat
tgggagtttgaagagtctgaggaggatccagtcaccagcatcccttaccagctgcaaagg
ttgtttgttctcctgcagaccagtaagaaacgggcaatcgagaccaccgacgtaacgcgg
agctttggttgggacagcagtgaggcttggcagcagcacgatgtccaggagctgtgtagg
gtcatgtttgatgccctggagcaaaagtggaagcagacagtgcaggctgacctgatcaac
cagctgtaccaggggaagttaaaagattacgtgcgctgtctggaatgtggctacgagagc
tggaggatcgatacttacctggacatccctctggttatcagacccttcggagccagccag
gcttacggcagtgtggaagaggctttgcaggcatttatccaaccagaaactctggatgga
cccaaccagtacttctgcgagcgttgccaaaagaaatgcgatgctcgaaaagggctgaga
ttcctgcactttccctacctgctgacgctccagctgaagcgctttgatttcgactacaac
actatgcatcgcatcaagctcaacgaccgcatgaccttccccgaggagctcgacatgagc
cccttcatcgatgtggaagatgagaagtcgcctcagacggagagctgcactgatagtggg
gccgagaacgaaggcagttgccacagtgaccagatgagcaacgatttttctacggatgat
tgtgtggatgaaggcatctgtttggacagcaccaacaatgcagacagaatgctgaagcca
aagagtttgccgacatttgagctgttctctgttatggtccattctgggagcgctgctggt
ggacattactatgcccacatcaaatccttcagtgatggccagtggtacagtttcaacgat
caacacgttagcaagatcactcaagacgatatcaggaagacatatggggggtcctcaggg
agcagaggttattactctagtgcctttgcaagctctacaaatgcatatatgctgatttat
agattgaaagacccctcaaggaacgcaaagtatttatctgtggaagacttcccagagcac
ataaagagtttggttcaaaaggagaaggagtcggaggagcaggagaagcgacagagagag
atcgaacgaaacacttgcaaaataaagctgttctgcatgcaccctgtaaagatgatgatg
gagagtaagctggaagtgcataaggacaaaaccctcagagaagcaacagagatggcctac
aagctgatggaactagaggggttggtcacgctggactgttgtcgtttggtgaagtatgat
gagttccacgagtatctggagcgctcatatgaaggcgaggaggacacaccaatgggtctt
ctcctgggaggagtcaagtcttcatacatgttcgatttgcttcttgagacccgcaggcct
gaccaggtgtttcaaccttacaaacctggagaagtgatggtgaaggttcacgttgtggac
ttggagagcgagaccatcgccgcttcagtcagcgtcagagcttatctgaaccagaccgtc
acagaattcaagcagcttattgcacaggctacaggtttatctgcagaaaccatgcgtgtg
gtcctggagcgctgttataatgaccttcgccttttgtatgttccaaataagactctgaaa
gctgagggcttcttcagaagcaacaaggtttttgtagagagctcaatctcatcggatcat
caggtcactttctctgactctttattgtggaagctgttggatcgtcatggaaatacaatc
cggcttttggtcttgctgcctgaacagtctccaggcacatcgaccaacagaactgtttgc
caaaaagtaggtgttgattctgatccatccttggacgggtcaaagggaaacaggaaatca
gtagaggctatcctggaagagagtacagaaaaactgaagaacctgtctctccagcagcag
cagcagcagcagcagcagcagcagcagggctccagcaccagcgacagccagaaaagctca
gatgccagtgactttgaacacattgaatctcccacccaagacgcagattccaactcttta
ctcggcgaggctgcagacaacagagagctggagaatcggatcaggatggccggcagcagc
ggcgcctcctccgaccctgagaaccactttgcctgtgaagagcggtcggactctgaggtc
aacaatgaccgcagcacgagctcggtggacagcgacatcttgagctccagtcacagcagc
gacacactgtgtaacgccgacagcgggcccttggcattggccaatggcctggactcacac
agcatcacaagtagccgtcgctccaaagcccacgagggcaaaaaggagacatgggacact
gctgaagaggactctgggacagacagtgaatacgatgacaatgggaagagcaaaggagag
gctcagtacctgtattttagaactgagccttgttcacagagtgactccacgtgtgacgca
caaaaatgtttagtggtttatgtggacaaaaggatcacattagcagcatttaaacagaac
ctggagccttacgtgggggtcccctccgctcagttcaaagtgtttcgggtttacgccaac
aaccaggagttcgagagcatccgactcaatgaaacactctcatcgttctctgacgataac
aagataacgatccgcctcggaagagctctgaaaaagggtgaatacagagtgaaggtgtac
cagctactcgtgaacgaagcagagccctgcaagttcctcgtggatacggtgtttgccaaa
ggcatgactgtcaggcagtccaaggaggagctgctcccgctgctgaaagaacagtgcaaa
ctggacctcaacattgacagggtccgtctcagaaagaagacgtggaaaaacccaggcacg
gtgtttctggactatcacgtttatgaagaagacatcagcatctcctccaactgggaggtt
ttcttggaagttctcaatgaatcagagaagatgaagtctatgtcacaactcgctgttctg
acccggagatggagcccttctacgatgaagctggggccttttcaggaggttatattggag
aacagcagcgtagacgaactgaaggaaaagctcagtgaaatgagtgacatcactcttgaa
aacctggactttgcaaagggcagaggaacttttccttgtgacatctctgtgctggagatc
cagcaggatttggactggaacccaaaggtctcaactctgaacgtgtggcctctgtacatc
tgtgatgacggcgctgtggtcttctacaggaacagcacagaggagcccatggagctgtcg
gaggatgagcgcagcgagctaatgaagagggagagcagccggctactgaagactggccac
cgtgtcagttattcaccgcgcaaagagaaggccctcaagatctacctggacggaggcccg
gccaaggacccgggacaggactga

DBGET integrated database retrieval system