KEGG   Takifugu rubripes (torafugu): 101068371Help
Entry
101068371         CDS       T02386                                 

Definition
protoporphyrinogen oxidase-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tru00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 485 aa AA seqDB search
MLDGWSELQMKTVAVLGGGIAGLAASYYLCRSPQVTKVILLESSSRVGGWLSSTRRPDGA
VFEHGPRGIRPAGAVGRNTLNMVDDLGLQDEIVPVSYSHVASKNRYLYVNKELHKMPSGI
RGLLQTVPPFSRPLLFNLVKEILVKKGQEDDETIHSFFCRRLGKEFADIAVDSLCRGVFA
GDCRKLSVRSCFPLLYNAEQRRGSVLLGMMLGSGPSPVVPPGPLALRSVKESWAQWSLRR
GVESLPESIAELLQRSGKVELHTDAPVKEIHPSASDWKIRLEDGLISADHIISALPAKAL
SSVLPSSCLPLTQRLMEIETVTVAVVNLEYEGSVLPVEGFGHLLPSSEDQAVLGVVYDSV
AFPQHNRPTGETTRLTVMMGGAWFHRAGGSLGAVTQGDLLSRATEAVRDHLDVTAAPIWS
HVEIQKDCIPQYYEGHAQRVESMRNFIKKENLPLSLIGSSYDGVSVNDVIFSGRTAAEEL
LGAQV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgttagatggctggtctgagctgcaaatgaaaacagtcgccgtccttggagggggcatc
gcaggcttggcagcatcgtactacctctgcaggagcccccaagtgaccaaggtcatttta
ttggagtccagtagtcgtgttggaggctggctgagctccaccaggaggccagatggagct
gtgtttgaacacggaccgagagggatacgacctgctggagcagtggggcgcaatactctc
aacatggtggatgacctgggtctgcaggatgagattgtaccagtttcctacagccacgtc
gcctccaagaacagatatctctatgtcaacaaggagctccacaagatgccttcaggaata
cgtggacttttgcaaactgtcccaccgttctctcgtcccctcctcttcaatcttgtcaag
gagatcctggtgaagaaaggccaggaggacgatgagaccatccattccttcttttgtcga
aggctggggaaggagtttgcagacatcgccgtggacagtttgtgtcgaggggtgtttgca
ggcgactgcaggaagttgagtgtgcgttcttgttttcctcttttgtacaatgcagagcag
cgcagaggttcggtgctgctgggaatgatgctgggctcaggccccagtcccgtggtgccc
cctgggcccctggccctcagatctgtgaaggagtcgtgggctcagtggtccctgagacgg
ggagtggagtctctcccagaatccatcgcagagttgctgcagcgcagtgggaaagtggag
cttcacaccgatgcacctgttaaagagattcatccttcagcctcggattggaagatccgt
ctggaggacggcctcatctcagcagaccacatcatctctgccctgccggccaaagctctc
tcctcggttctgccctcctcctgcctacctttgacccaacggttgatggagattgagacg
gtgacggtcgccgtggtaaatctggaatatgagggttctgttctgccagtggaggggttt
ggtcatctgctcccatcctcagaggaccaggctgtactgggagtggtctatgattctgta
gcctttcctcagcacaacagacctactggggagaccaccagactgacggtgatgatgggc
ggggcctggtttcacagagcaggtgggtctctgggagcagtaacgcagggggatcttctg
tcacgagccactgaagctgtgcgcgatcacctggacgtgactgcagcacccatctggagt
cacgtagagattcagaaggattgtattcctcagtattatgaaggacacgctcagagagtg
gagtccatgcgtaacttcataaagaaggaaaatctgcctttatcgctgattggctcgtcc
tacgatggcgtgtccgttaatgatgtcatcttcagtggacgcacggctgcggaggagttg
ttgggagctcaagtctga

DBGET integrated database retrieval system