KEGG   Takifugu rubripes (torafugu): 101068371Help
Entry
101068371         CDS       T02386                                 

Gene name
ppox
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00860  Porphyrin and chlorophyll metabolism
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101068371 (ppox)
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101068371 (ppox)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     101068371 (ppox)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 MCRA Pyr_redox_2 FAD_oxidored FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 101068371
NCBI-ProteinID: XP_011603457
Position
7
AA seq 476 aa AA seqDB search
MKTVAVLGGGIAGLAASYYLCRSPQVTKVILLESSSRVGGWLSSTRRPDGAVFEHGPRGI
RPAGAVGRNTLNMVDDLGLQDEIVPVSYSHVASKNRYLYVNKELHKMPSGIRGLLQTVPP
FSRPLLFNLVKEILVKKGQEDDETIHSFFCRRLGKEFADIAVDSLCRGVFAGDCRKLSVR
SCFPLLYNAEQRRGSVLLGMMLGSGPSPVVPPGPLALRSVKESWAQWSLRRGVESLPESI
AELLQRSGKVELHTDAPVKEIHPSASDWKIRLEDGLISADHIISALPAKALSSVLPSSCL
PLTQRLMEIETVTVAVVNLEYEGSVLPVEGFGHLLPSSEDQAVLGVVYDSVAFPQHNRPT
GETTRLTVMMGGAWFHRAGGSLGAVTQGDLLSRATEAVRDHLDVTAAPIWSHVEIQKDCI
PQYYEGHAQRVESMRNFIKKENLPLSLIGSSYDGVSVNDVIFSGRTAAEELLGAQV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtcgccgtccttggagggggcatcgcaggcttggcagcatcgtactacctc
tgcaggagcccccaagtgaccaaggtcattttattggagtccagtagtcgtgttggaggc
tggctgagctccaccaggaggccagatggagctgtgtttgaacacggaccgagagggata
cgacctgctggagcagtggggcgcaatactctcaacatggtggatgacctgggtctgcag
gatgagattgtaccagtttcctacagccacgtcgcctccaagaacagatatctctatgtc
aacaaggagctccacaagatgccttcaggaatacgtggacttttgcaaactgtcccaccg
ttctctcgtcccctcctcttcaatcttgtcaaggagatcctggtgaagaaaggccaggag
gacgatgagaccatccattccttcttttgtcgaaggctggggaaggagtttgcagacatc
gccgtggacagtttgtgtcgaggggtgtttgcaggcgactgcaggaagttgagtgtgcgt
tcttgttttcctcttttgtacaatgcagagcagcgcagaggttcggtgctgctgggaatg
atgctgggctcaggccccagtcccgtggtgccccctgggcccctggccctcagatctgtg
aaggagtcgtgggctcagtggtccctgagacggggagtggagtctctcccagaatccatc
gcagagttgctgcagcgcagtgggaaagtggagcttcacaccgatgcacctgttaaagag
attcatccttcagcctcggattggaagatccgtctggaggacggcctcatctcagcagac
cacatcatctctgccctgccggccaaagctctctcctcggttctgccctcctcctgccta
cctttgacccaacggttgatggagattgagacggtgacggtcgccgtggtaaatctggaa
tatgagggttctgttctgccagtggaggggtttggtcatctgctcccatcctcagaggac
caggctgtactgggagtggtctatgattctgtagcctttcctcagcacaacagacctact
ggggagaccaccagactgacggtgatgatgggcggggcctggtttcacagagcaggtggg
tctctgggagcagtaacgcagggggatcttctgtcacgagccactgaagctgtgcgcgat
cacctggacgtgactgcagcacccatctggagtcacgtagagattcagaaggattgtatt
cctcagtattatgaaggacacgctcagagagtggagtccatgcgtaacttcataaagaag
gaaaatctgcctttatcgctgattggctcgtcctacgatggcgtgtccgttaatgatgtc
atcttcagtggacgcacggctgcggaggagttgttgggagctcaagtctga

DBGET integrated database retrieval system