KEGG   Takifugu rubripes (torafugu): 101068479Help
Entry
101068479         CDS       T02386                                 

Definition
asparagine synthetase [glutamine-hydrolyzing]-like
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101068479
Enzymes [BR:tru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     101068479
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C44
   101068479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 560 aa AA seqDB search
MCGIWAVFGSNGCLSGHLVNAMKVAHRGPDAFRIENINGFTNCCFGFHRLAIMDQLHGMQ
PLRIMQFPYLWLCYNGEIYNHLLLRKQFGFDHQTEMDGEILLHLYDRFGAKKMASLLDGV
FAFILLDTANKRVCVGRDTFGVRPLFRCLTDDGFLGVCSEAKGLTKLSSLEASASVTPFP
PGHVEVFDLKPDGKVESIQMEAFHLCTQEPAHAAYDSVPALPSGFDEETVKSNIRTLFEN
AVRKRLMAQRRIACLLSGGLDSSLVSATLMKLAKEEKLQYPLQTFSIGSEDSPDLLAARK
VAAHIGSEHHEMNFSIQEGIQAVKDVIYHLETYDITTIRASVPMFLISKYIREKSDSVVI
FSGEGSDELTQGYIYFHKAPDPAAAAAESVRLMEELYMFDVLRSDRTTAAHGLELRVPFL
DHRFTAYYLSLPEAMRVPKNGVEKFLLRDSFSGLNLLPDGILWRRKEAFSDGLTSLKKSW
YTWLQEHVESLVSDDQLEKARHTYPHNPPPTKEAYYFRQIFEEFFPNQAKWLPHYWMPKW
LKATDPSARTLPFYEPEKVE
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatctgggccgtgtttggcagcaacgggtgcctgtcgggtcacctcgtcaac
gccatgaaggtggcccaccgaggccccgacgccttccgcatcgagaacatcaacggcttc
accaactgctgcttcggcttccatcgcttggccatcatggaccagctgcacggcatgcag
ccgctgcgcatcatgcagttcccctacctgtggctctgctacaacggggagatctacaac
cacctcttgctgaggaagcagtttgggtttgaccaccagaccgagatggacggagagatc
ctgctccatctgtacgatcgcttcggcgccaagaagatggcgtccctcctggacggcgtc
tttgcctttattctgctggacaccgccaacaagagggtctgtgtgggcagggacaccttc
ggagtgcggcctttgttcagatgcctgacggacgacgggttccttggcgtctgctccgag
gccaaaggtctgacgaaactgagctccttggaggcttccgccagcgtcacccccttcccc
ccgggccacgtcgaggtcttcgatttgaagccggacggcaaagtcgagtcgatccagatg
gaagcgtttcacctctgcacgcaggagccggctcacgccgcctacgacagcgtccccgcg
ctgccttcaggtttcgacgaggaaacggtgaaatccaacatcagaactctgtttgagaac
gccgtcaggaaacggctcatggcccagaggcggatcgcctgcctcctgtcaggcggtctg
gactccagcctggtttctgccaccctcatgaagctggccaaagaggagaagctgcagtac
cctctccagaccttctccatcggctcggaggacagccccgacctgttggcggcccgaaag
gtggcggctcacatcggcagcgagcaccacgagatgaacttcagcatccaggaaggaatc
caggcggtcaaggacgtcatctatcacctggagacctatgacatcaccaccatccgcgcc
tctgtccccatgttcctgatatcgaagtacatcagggagaagtcggacagcgtggtgatc
ttctctggggagggttctgacgagctcacgcagggctacatctacttccacaaggctccc
gatcctgcggcggcagcggcagaaagcgtccggctgatggaggaactttacatgttcgac
gtcctccggagtgatcgcaccactgctgcacacgggctggagctcagagttcctttcctt
gaccacaggtttacagcgtactacctgtccctgcccgaggccatgagggttccaaagaac
ggagtggagaagttccttctgagggactccttctcaggtctcaacttgctcccagacggg
atcctgtggaggcgcaaagaggccttcagcgatggtttgacatcgctgaagaagtcgtgg
tacacctggctgcaggagcatgtggagtcgctggtgagcgatgaccagttggagaaggct
aggcacacgtacccccacaaccccccacccaccaaagaggcgtactacttcaggcagatc
tttgaggagttcttcccaaaccaggctaaatggcttcctcattactggatgccaaagtgg
ctaaaggccacggacccctcagctcggaccctccctttctatgagccagagaaagtagaa
tga

DBGET integrated database retrieval system