KEGG   Takifugu rubripes (torafugu): 101068588Help
Entry
101068588         CDS       T02386                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00561  Glycerolipid metabolism
tru01100  Metabolic pathways
Module
tru_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101068588 (mgll)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101068588 (mgll)
Peptidases [BR:tru01002]
 Serine Peptidases
  Family S33
   101068588 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Peptidase_S9 Abhydrolase_2 DLH Abhydrolase_5 PGAP1 LIDHydrolase Thioesterase Ser_hydrolase DUF1350 Abhydrolase_3 FSH1 DUF1057 PAF-AH_p_II DUF2048
Motif
Other DBs
NCBI-GeneID: 101068588
NCBI-ProteinID: XP_003963079
Position
3
AA seq 258 aa AA seqDB search
VFIAHGAGEHSGPYDELAQRLKELSLLAFAHDHVGHGQSEGERMNIKDFQIYIRDSLQHI
DLMKSRHPDLPVFIVGHSMGGAISILTACERPTEFAGVVLIAPMVQMNPESATPFKVFLA
KVLNHLMPSLTLGSIQSKWVSRDKKQVEAYNADELNFHGGLRVSFGMQLMAAASRIEAEI
PSIKWPFLLLHGDADKLCDMRGSTMMYENTPSSDKKFKIFEGGYHCLHHDLPEVAESVLK
DVSGWILERLPAEPSQQP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtcttcatcgcgcacggggccggagagcattctgggccttacgacgagctggcgcagagg
ctgaaggaactctccctgctggccttcgcgcacgaccacgtcggccacggtcagagcgaa
ggagagcgcatgaacatcaaggatttccagatttacatccgagactccctgcagcacatc
gacctgatgaaatcccgccacccggaccttcccgtcttcatcgtgggccactccatgggc
ggcgccatctccatcctgacagcatgtgagcggcccaccgagtttgccggagtggttctg
attgccccgatggtccagatgaacccagagtcggccacaccgttcaaggtgttcctggcg
aaggtcctgaaccacctgatgcccagcctgactctgggatccatccagtcaaagtgggtc
tctcgggacaagaagcaggtggaggcgtacaacgcggatgagctgaacttccacggcggc
ctacgcgtgtccttcggcatgcagctgatggcggcggcgtcccgcatcgaggcggagatc
ccgtccatcaagtggcccttcctgctgctgcacggcgacgccgacaagctctgcgacatg
agaggctccacgatgatgtacgagaacactccgagctccgacaagaaattcaagatcttc
gagggaggctaccactgccttcaccacgacctccccgaagtcgctgagtccgtgctgaag
gacgtgagcggctggatcctggagcgactcccggctgagccatcgcagcagccctga

DBGET integrated database retrieval system