KEGG   Takifugu rubripes (torafugu): 101068590Help
Entry
101068590         CDS       T02386                                 

Definition
neuroendocrine convertase 2-like
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     101068590
Peptidases [BR:tru01002]
 Serine Peptidases
  Family S8: subtilisin family
   101068590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 641 aa AA seqDB search
MRGSPRHRTAAGWMVLLNALLLSTQPAHGAITDHLLVQLRGDAQDEAHQLATQHGFQSAR
KLPFGEGLFHFYPQDASKRRNKRSTHRRQQLQKDNRVKDVFEQEGFSRQKRGYRNIDDIE
VNMSDPLFTKQWYLINTGQADGTPGLDLNVAEAWQLGYTGKGVTIAIMDDGIDYLHPDLA
SNYNADASYDFSSNDPFPFPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYSSKVAGI
RMLDQPFMTDVIEASSISHMPQLIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGRG
GKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNG
RKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLSVLTSK
RNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMAKDWKTVPERFHCVAGSIQESHK
IQSGRKLVLAINTEACQGKDNFVRYLEHVQAVVTVNASRRGDLNINMTSPMGTKSILLSR
RPRDDDAKVGFDKWPFMTTHTWGEDPRGTWLLEVGFQGKEPQHGVLKEWTLMLHGTQSAP
YIDQIVRDYKSKLAMSKKEELEEELDEAVERSLNSLLSKTN
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgggtctccccgacacaggacagcggcgggatggatggtgctgctgaatgcgctg
ctgctctcgacgcagcccgcacacggtgccatcacggaccatctcctggttcagctgcgc
ggggacgcacaggacgaggcgcaccaacttgcaactcagcacgggtttcagagtgcaaga
aagcttcccttcggagaggggctctttcacttttatcctcaagatgcttcaaagaggagg
aataagcgcagcacgcacagaagacagcagctccaaaaagacaacagggtgaaggatgtc
ttcgagcaagaggggttcagccgtcagaagcgaggctacagaaatatcgacgacattgaa
gtcaacatgagcgatcctctgttcaccaaacagtggtatttgataaacacaggccaagcg
gacggcacccccgggctggatcttaatgtggctgaagcatggcaactgggctacacggga
aaaggcgtgaccatcgcaatcatggacgatggcattgactacctgcacccagacctggca
tcgaactataatgccgatgccagctacgacttcagcagcaatgacccgttcccatttcca
cgctacacagatgactggttcaacagtcacggcacacggtgtgctggagaggtgtctgca
gcagccaacaacaacatctgcggtgtgggagtcgcgtacagctccaaggtggcaggcatc
aggatgctggatcaacccttcatgactgacgtcattgaggcgtcgtccatcagccacatg
ccgcagctcatcgacatctacagcgccagctggggccccaccgatgatggcaagacggtg
gatgggccccgagagctcacgctgcaggccatggctgacggtgtcaacaaggggcgtgga
ggcaaaggcagcatctatgtgtgggcctcgggagacggcggcagctacgacgactgcaac
tgcgacggctatgcttcaagcatgtggaccatctccatcaactcggccatcaacgacggc
cgcacggccctgtacgacgagagctgctcctccaccctggcctccaccttcagcaacggc
cgcaagaggaacccagaggccggagtggcaaccacagacctgtacgggaactgcacgcta
cgtcactctggaacctcggcggcggctcctgaggcggccggtgtctttgctctggcccta
gaagctaaccccaacctgacatggagggatatgcagcacttgtctgtgctgacctccaag
aggaaccaactccacgacgaggttcaccagtggaggaggaacggcgtgggtctggagttt
aaccacctgtttggctacggcgtgctggacgctggggggatggtgaaaatggccaaggac
tggaaaacggtgcctgagcgtttccactgcgtcgccggatccatccaggaatcccataaa
atccaatctggcagaaagctagtgctggccatcaacaccgaggcctgccagggcaaggac
aactttgtccgctacctggagcacgttcaggcagtggtcacggtcaacgccagtcgccgt
ggcgacctcaacatcaacatgacctcccccatgggaacaaagtccattctgctaagtcga
aggccccgtgacgacgacgccaaggtgggcttcgacaagtggcccttcatgaccacccac
acctggggggaagacccccgtgggacctggcttctggaggtgggctttcagggtaaggag
ccacagcacggtgtcctaaaggagtggaccctcatgctgcacggaacacaaagtgcccct
tatatagaccagatagtgcgtgattataagtccaaactggccatgtctaaaaaggaagag
ctggaggaggagctggacgaggccgtggagagaagtctgaacagcttgctgagtaaaacc
aactga

DBGET integrated database retrieval system