KEGG   Takifugu rubripes (torafugu): 101068602Help
Entry
101068602         CDS       T02386                                 

Definition
muscarinic acetylcholine receptor M4-like
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Neuroactive ligand-receptor interaction
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:tru04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:tru04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 487 aa AA seqDB search
MGRASPYKALEMFFIALVTGSLSFVTVTGNILVMLSIKVNRHLQTVNNYFLFSLACADLI
IGVFSMNLYTVYIIVGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTY
PTRRTTKMAGLMIAAAWILSFILWAPAILFWQFIVGERTVLPGECYIQFLSNPAVTFGTA
IAAFYLPVIIMTVLYINISLASRSRVSKHREEKKEKKGIKTPNLIKSHLLKQNNNNETSP
HASPRSSPKLSLDSTMTAVDTVKNGKVDEPKPVQQQPPAQPSPGLTQEKESSNDSSTAFI
TPTEPKDNNKNDGVPQVATHSNPVATATVNPAEPKISSNSKWSKIKIVTKRAGDECITAL
EIVPPVEGAERHSIPISRPRTVARKFASIARSQVKRKRQMAAREKKVTKTIFAILLAFII
TWTPYNVMVLISTFCQSCVPDTVWAIGYWLCYVNSTINPACYALCNATFKKTFKNLLLCQ
YKNIGTR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggggagagcaagtccatacaaagccctggagatgttttttattgcacttgttacagga
tctctgagttttgtgactgttacaggaaacattttagtcatgctctctatcaaagtaaac
cgccacctacaaactgtcaataactatttcttattttcattagcctgtgctgacttgatc
atcggcgtgtttagcatgaatttgtacacagtctatatcatagtgggctactggcccctc
ggtcctgtcgtctgtgacttatggctagcactagattatgttgtgtcaaacgcttcagtg
atgaacttactaatcatcagttttgatcgctatttctgtgtgaccaagcccttaacatat
ccaacacgaaggacaacaaagatggcaggattaatgattgcagctgcctggatcttgtcc
ttcatcttgtgggctcctgccattttgttctggcagttcatcgttggagagcgaacggtc
ctacctggagaatgttatattcagttcctttctaaccctgcagtgacatttgggacagct
atagcagcattctatcttccagtcatcatcatgacagtcctgtacatcaacatttctctg
gcctccagaagtagagtttccaaacacagggaagagaagaaagagaagaaagggataaaa
actcccaacttgattaaaagtcacctgttaaagcagaacaacaataatgaaaccagccct
catgccagtccacgctccagtcccaaattaagtctagactccacaatgaccgcagtagac
actgtaaagaatggtaaagttgacgaaccaaaaccagttcaacagcagcctccagcacaa
cccagcccagggcttacacaggaaaaagagagctccaacgactcatccacagcttttatc
acccccacagaaccaaaggacaacaacaaaaatgatggggtacctcaggtggcaacacat
tccaacccagttgctacagcaacagtgaatcctgctgaaccgaagatcagctccaattca
aagtggtcaaagataaagattgtaacgaagagggctggagatgaatgcatcactgctttg
gagatcgttcctcctgtagagggagctgagagacattcaatccccatcagtcgtccaaga
actgtggcaagaaaatttgcgagcattgcgagaagccaagtgaagagaaaaagacagatg
gctgccagagaaaagaaagtgaccaagaccatctttgccatcctgttggctttcatcatt
acgtggacaccgtataacgtcatggtgttgatctcaaccttctgccagtcctgtgtgcca
gacactgtgtgggcaattggatattggctgtgttatgtcaactctactataaacccggct
tgttacgcactgtgcaatgccacgttcaaaaagacattcaagaatctcttgctctgccag
tataaaaacataggtacgagatga

DBGET integrated database retrieval system